DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313b1 and Cyp4a14

DIOPT Version :9

Sequence 1:NP_001287239.1 Gene:Cyp313b1 / 41019 FlyBaseID:FBgn0037601 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_031848.1 Gene:Cyp4a14 / 13119 MGIID:1096550 Length:507 Species:Mus musculus


Alignment Length:518 Identity:132/518 - (25%)
Similarity:231/518 - (44%) Gaps:60/518 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSG---WLLLAWLYFLWSR--RRYYKVAWQLRG-------PIGWPLIGMGLQMMNPETFLQYMDG 59
            :||   |..|..|:.:..:  :.|.:..|.|:.       |..| |.|..|:....:..|.::: 
Mouse    15 ISGFFQWAFLLSLFLVLFKAVQFYLRRQWLLKTLQHFPCMPSHW-LWGHHLKDKELQQILIWVE- 77

  Fly    60 LSRQFKAPFISWM-GTSCFLYINDPHSVEQILNSTHCTNKGDFYRFMSSAIGDGLFTSSSPRWHK 123
               :|.:..:..: |::..:.:.||..|:.:|..:.....| .|:|.:..||.||...:..:|.:
Mouse    78 ---KFPSACLQCLSGSNIRVLLYDPDYVKVVLGRSDPKASG-IYQFFAPWIGYGLLLLNGKKWFQ 138

  Fly   124 HRRLINPAFGRQILSNFLPIFNAEAEVLLQKLE-LEGVQHGKRLEIYQILKKIVLEAACQTTMGK 187
            |||::.|||...||..::.|......::|.|.| |:|..|  .|||:..:..:.|:    |.|  
Mouse   139 HRRMLTPAFHYDILKPYVKIMADSVNIMLDKWEKLDGQDH--PLEIFHCVSLMTLD----TVM-- 195

  Fly   188 KMNFQHDGSLCI-------FKAYNGLTEVCVKRMLSPWLYPDLIYRRSGLFRLQQKVVGILFGFI 245
            |..|.:.||:.:       .||...|..:...|:.:.:...::||..|...||......|..   
Mouse   196 KCAFSYQGSVQLDENSKLYTKAVEDLNNLTFFRLRNAFYKYNIIYNMSSDGRLSHHACQIAH--- 257

  Fly   246 EQLLEPIVSVVAANSNPDQQRSEMEMRGKSKAI-FIEQV--REHVERGQLSWQDVRDEANVTIAA 307
                |....|:....:..|...|::...|.:.: |::.:  ....:|..||.:|:|.|.:..:..
Mouse   258 ----EHTDGVIKMRKSQLQNEEELQKARKKRHLDFLDILLFARMEDRNSLSDEDLRAEVDTFMFE 318

  Fly   308 TFETTSTALYFTILCLAMHPCYQEKLHKELVTELPPSGDINLEQLQRLEYTEMVINEAMRLFAPV 372
            ..:||::.:.:....||.||.:|::..:|:.:.|.....:..:.|.::.||.|.|.||:||:.||
Mouse   319 GHDTTASGISWIFYALATHPEHQQRCREEVQSILGDGTSVTWDHLGQMPYTTMCIKEALRLYPPV 383

  Fly   373 PMVLRSADQDIQLKRGDGEFLIPRGTQIGIDIYNMQRDERVWGPLSRTYNPDAHFGLDSPQRHAF 437
            ..|.|.....:....|..   ||:|....|.||.:..:.|.| |..:.::| :.|..|| ..|:.
Mouse   384 ISVSRELSSPVTFPDGRS---IPKGITATISIYGLHHNPRFW-PNPKVFDP-SRFAPDS-SHHSH 442

  Fly   438 AFVPFTKGLRMCIGYRYAQMLMKLLLARIFRSYRISTE--------ARLEELLVKGNISLKLK 492
            |::||:.|.|.|||.::|...:|:.:|.....:.:..:        ||| .|..|..|.|.||
Mouse   443 AYLPFSGGSRNCIGKQFAMNELKVAVALTLLRFELLPDPTRIPVPIARL-VLKSKNGIHLCLK 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313b1NP_001287239.1 p450 33..474 CDD:299894 115/459 (25%)
Cyp4a14NP_031848.1 p450 52..501 CDD:278495 121/476 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.