DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313b1 and Cyp4a12b

DIOPT Version :9

Sequence 1:NP_001287239.1 Gene:Cyp313b1 / 41019 FlyBaseID:FBgn0037601 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_758510.2 Gene:Cyp4a12b / 13118 MGIID:3611747 Length:508 Species:Mus musculus


Alignment Length:414 Identity:114/414 - (27%)
Similarity:197/414 - (47%) Gaps:32/414 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 RQFKAPFISWM-GTSCFLYINDPHSVEQILNSTHCTNKGDFYRFMSSAIGDGLFTSSSPRWHKHR 125
            :.|.:....|: |:...:.:.||..::.||..:.....|. |||::..||.||.......|.:||
Mouse    78 KNFPSACPQWLWGSKVRIQVYDPDYMKLILGRSDPKAHGS-YRFLAPWIGRGLLLLDGQTWFQHR 141

  Fly   126 RLINPAFGRQILSNFLPIFNAEAEVLLQKLELEGVQHGKRLEIYQILKKIVLEAACQTTMGKKMN 190
            |::.|||...||..:..|......|:|.|.| :.|.....|||:|.:..:.|:    |.|  |..
Mouse   142 RMLTPAFHYDILKPYTEIMADSVHVMLDKWE-QIVGQDSTLEIFQHITLMTLD----TIM--KCA 199

  Fly   191 FQHDGSLCI---FKAY----NGLTEVCVKRMLSPWLYPDLIYRRSGLFRLQQKVVGILFGFIEQL 248
            |.|:||:.:   :|:|    ..|..:...|:.:.:...|:|||.|....|......:.....:| 
Mouse   200 FSHEGSVQLDRKYKSYIQAVEDLNNLFFLRVRNIFHQNDIIYRVSSNGCLANSACQLAHDHTDQ- 263

  Fly   249 LEPIVSVVAANSNPDQQRSEME-MRGKSKAIFIE-QVREHVERGQ-LSWQDVRDEANVTIAATFE 310
                  |:.:..:..|...|:| ::.|.:..|:: .:...:|.|: ||.:|:|.|.:..:....:
Mouse   264 ------VIKSRRSQLQDEEELEKLKKKRRLDFLDILLFARMENGKSLSDKDLRAEVDTFMFEGHD 322

  Fly   311 TTSTALYFTILCLAMHPCYQEKLHKELVTELPPSGDINLEQLQRLEYTEMVINEAMRLFAPVPMV 375
            ||::.:.:....||.:|.:|::..||:.:.|.....|....|.::.||.|.|.||:|::.|||.|
Mouse   323 TTASGISWIFYALATNPEHQQRCRKEIQSLLGDGASITWNDLDKMPYTTMCIKEALRIYPPVPSV 387

  Fly   376 LRSADQDIQLKRGDGEFLIPRGTQIGIDIYNMQRDERVWGPLSRTYNPDAHFGLDSPQRHAFAFV 440
            .|.....:...  ||..| |:|..:.:..|.:..:..|| |....::| :.|...| .||:.:|:
Mouse   388 SRELSSPVTFP--DGRSL-PKGIHVMLSFYGLHHNPTVW-PNPEVFDP-SRFAPGS-SRHSHSFL 446

  Fly   441 PFTKGLRMCIGYRYAQMLMKLLLA 464
            ||:.|.|.|||.::|...:|:.:|
Mouse   447 PFSGGARNCIGKQFAMNELKVAVA 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313b1NP_001287239.1 p450 33..474 CDD:299894 114/414 (28%)
Cyp4a12bNP_758510.2 CYP4B-like 70..503 CDD:410771 114/414 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.