DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313b1 and LOC1280196

DIOPT Version :10

Sequence 1:NP_649807.1 Gene:Cyp313b1 / 41019 FlyBaseID:FBgn0037601 Length:502 Species:Drosophila melanogaster
Sequence 2:XP_320019.5 Gene:LOC1280196 / 1280196 VectorBaseID:AGAMI1_011489 Length:512 Species:Anopheles gambiae


Alignment Length:37 Identity:11/37 - (29%)
Similarity:17/37 - (45%) Gaps:3/37 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 LRLTYFQKRNIHDKPVNTPEDPLAEDRYEKEEFFDML 157
            |.||.......||   :||:|.|.::......||:.:
Mosquito    13 LFLTPTHSHQGHD---DTPKDSLLQNISRSAHFFNKI 46

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313b1NP_649807.1 CYP313-like 66..498 CDD:410680 11/37 (30%)
LOC1280196XP_320019.5 None

Return to query results.
Submit another query.