DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313b1 and CYP46A1

DIOPT Version :9

Sequence 1:NP_001287239.1 Gene:Cyp313b1 / 41019 FlyBaseID:FBgn0037601 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_006659.1 Gene:CYP46A1 / 10858 HGNCID:2641 Length:500 Species:Homo sapiens


Alignment Length:471 Identity:121/471 - (25%)
Similarity:199/471 - (42%) Gaps:116/471 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 INDPHSVEQILNSTHCTNKGDFYRFMSSAIGDGLF------TSSSPRWHKHRRLINPAFGRQILS 138
            :..|.||::.|.||........||.:.:..|:.||      ..:..||||.||:|:.||.|..|.
Human    87 VTSPESVKKFLMSTKYNKDSKMYRALQTVFGERLFGQGLVSECNYERWHKQRRVIDLAFSRSSLV 151

  Fly   139 NFLPIFNAEAEVLLQKLELEGVQHGKRLEIYQILKKIVLEAACQTTMGKKMNFQHDGSLCIFKAY 203
            :.:..||.:||.|::                      :|||                     || 
Human   152 SLMETFNEKAEQLVE----------------------ILEA---------------------KA- 172

  Fly   204 NGLTEVCVKRMLSPWLYPDLIYRRSGLFRLQQKVVGILFGF---IEQLLEPIVSVVAANSN---- 261
            :|.|.|.::.||:   |..:.......|.::   ..:|.|.   :.|.::.::..:.|:.|    
Human   173 DGQTPVSMQDMLT---YTAMDILAKAAFGME---TSMLLGAQKPLSQAVKLMLEGITASRNTLAK 231

  Fly   262 --PDQQRSEMEMRGKSKAIFIEQV--------REHVERGQLSWQDV------------RDEANVT 304
              |.:::...|:|...:  |:.||        ||.::||:....|:            .||..:.
Human   232 FLPGKRKQLREVRESIR--FLRQVGRDWVQRRREALKRGEEVPADILTQILKAEEGAQDDEGLLD 294

  Fly   305 IAATF-----ETTSTALYFTILCLAMHPCYQEKLHKELVTELPPSGDINLEQLQRLEYTEMVINE 364
            ...||     ||::..|.||::.|:..|....:|..|:...:.....::.|.|.||:|...|:.|
Human   295 NFVTFFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVIGSKRYLDFEDLGRLQYLSQVLKE 359

  Fly   365 AMRLFAPVPMVLRSADQDIQLKRGDGEFLIPRGTQIGIDIYNMQR-DERVWGPLSRTYNPDAHFG 428
            ::||:.|.....|..:::..:   || ..:|..|.:....|.|.| |.....||  |:||| .||
Human   360 SLRLYPPAWGTFRLLEEETLI---DG-VRVPGNTPLLFSTYVMGRMDTYFEDPL--TFNPD-RFG 417

  Fly   429 LDSPQRHAFAFVPFTKGLRMCIGYRYAQMLMKLLLARIFRSYRISTEARLEELLVKG-------N 486
            ..:| :..|.:.||:.|.|.|||.::|||.:|:::|::.:        |||..||.|       .
Human   418 PGAP-KPRFTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQ--------RLEFRLVPGQRFGLQEQ 473

  Fly   487 ISLKLKDYPLCRVERR 502
            .:||..|..||.:..|
Human   474 ATLKPLDPVLCTLRPR 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313b1NP_001287239.1 p450 33..474 CDD:299894 109/434 (25%)
CYP46A1NP_006659.1 p450 34..466 CDD:365848 114/446 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.