DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85e and Or98b

DIOPT Version :9

Sequence 1:NP_001262374.1 Gene:Or85e / 41018 FlyBaseID:FBgn0026399 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster


Alignment Length:462 Identity:84/462 - (18%)
Similarity:170/462 - (36%) Gaps:115/462 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ESNLFRLLMGLQLANGTKPSPRLPKWWPKRLEMIGKVLPKAYCSMVIFTS-LHLGVLFTKTTLDV 88
            :|.||||| ||:|.:......|.|  |            ::.|.::...| :.|.:.|....:. 
  Fly    10 QSALFRLL-GLELLHEQDVGHRYP--W------------RSICCILSVASFMPLTIAFGLQNVQ- 58

  Fly    89 LPTGELQAITDALTMTII------------YFFTGY----GTIYWCLRSRRLLAYMEH-MNREYR 136
                .::.:||:|...::            :.:..:    |..|..|::....|..|. :.||.|
  Fly    59 ----NVEQLTDSLCSVLVDLLALCKIGLFLWLYKDFKFLIGQFYCVLQTETHTAVAEMIVTRESR 119

  Fly   137 HHSLAGVTFVSSHAAFRMSRNFTVVWIMSCLLGVISWGVSPLMLGIRMLPLQCWYPFDALGPGTY 201
            ...     |:|:..|:    .|....:.:||:..:|..:|....|    .||..:||.::.|   
  Fly   120 RDQ-----FISAMYAY----CFITAGLSACLMSPLSMLISYQRTG----ELQPKFPFPSVYP--- 168

  Fly   202 TAVYATQLFGQIMVGMTFGFGGSLFVTLSLLLLGQFDVLYCSLKNLDAHTKLLGGESVNGLSSLQ 266
               :........::...:....:|.|.|..:.:   |.|:|||.:                    
  Fly   169 ---WDNMKLSNYIISYFWNVCAALGVALPTVCV---DTLFCSLSH-------------------- 207

  Fly   267 EELLLGDSKRELNQYVLLQEHPTDLLRLSAGRKCPDQGNAFHNALVECIRLHRFILHCSQELENL 331
                        |...|.|.....::... ||...:.    |..|....:|:...|:....|...
  Fly   208 ------------NLCALFQIARHKMMHFE-GRNTKET----HENLKHVFQLYALCLNLGHFLNEY 255

  Fly   332 FSPYCLVKSLQITFQLCLLVFVGVSGTREVLR--IVNQLQYLGLTIFELLMFTYCGELLSRHSIR 394
            |.| .:.:.:..:..||:|.:   ..:..:|:  ::....:....:.::.::.:||..:......
  Fly   256 FRP-LICQFVAASLHLCVLCY---QLSANILQPALLFYAAFTAAVVGQVSIYCFCGSSIHSECQL 316

  Fly   395 SGDAFWRGAWWKHAHFIRQDILIFLVNSRRAVHVTA-------GKFYVMDVNRLRSVITQAFSFL 452
            .|.|.:..:|   .|.:::::.  ||:|.:...:.:       |.|:..:...|.:::..|.|::
  Fly   317 FGQAIYESSW---PHLLQENLQ--LVSSLKIAMMRSSLGCPIDGYFFEANRETLITIVRTAISYV 376

  Fly   453 TLLQKLA 459
            |||:.||
  Fly   377 TLLRSLA 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85eNP_001262374.1 7tm_6 120..449 CDD:251636 55/338 (16%)
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 61/380 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.