DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85e and Or94b

DIOPT Version :9

Sequence 1:NP_001262374.1 Gene:Or85e / 41018 FlyBaseID:FBgn0026399 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_524456.1 Gene:Or94b / 42712 FlyBaseID:FBgn0039034 Length:383 Species:Drosophila melanogaster


Alignment Length:416 Identity:89/416 - (21%)
Similarity:143/416 - (34%) Gaps:109/416 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LHLGVLFTKTTL---DVLPTGELQAITDALTMTIIYFFTGYGTIYWCLRSRRLLAYMEHMNREYR 136
            |||.:.||...|   :.:.:.:.:.....|.|:|                ..|....:.:|..||
  Fly    45 LHLPLTFTYIALMWYEAITSSDFEEAGQVLYMSI----------------TELALVTKLLNIWYR 93

  Fly   137 HHSLAGVTFVSSH-AAFRM------------SRNFTVV---WIMSCLLGVISWGVSPLMLGIRML 185
            .|..|.:.....| .||.:            .|||..:   :|...|...:...:|........|
  Fly    94 RHEAASLIHELQHDPAFNLRNSEEIKFWQQNQRNFKRIFYWYIWGSLFVAVMGYISVFFQEDYEL 158

  Fly   186 PLQCWYPFDALGPGTYTAVYATQLFGQIMVGMTFGFGGSLFVTLSLLLLGQFDVLYCSLKNLDAH 250
            |...:.||:......|  .||   :|..:|.||.                      |.|.|:...
  Fly   159 PFGYYVPFEWRTRERY--FYA---WGYNVVAMTL----------------------CCLSNILLD 196

  Fly   251 TKLLGGESVNGLSSLQEELLLGDSKRELNQYVLLQEHPTDLLRLSAGRKCPDQGNAFHNALVECI 315
            |                          |..|.:.  |...|.||...|.     .|..||..|..
  Fly   197 T--------------------------LGCYFMF--HIASLFRLLGMRL-----EALKNAAEEKA 228

  Fly   316 R--------LHRFILHCSQELENLFSPYCLVKSLQITFQLCL----LVFVGVSGTREVLRIVNQL 368
            |        ||..:...::|.|.|.|||.|.:.:...|.:|.    ||.:|.. .|..| .|..:
  Fly   229 RPELRRIFQLHTKVRRLTRECEVLVSPYVLSQVVFSAFIICFSAYRLVHMGFK-QRPGL-FVTTV 291

  Fly   369 QYLGLTIFELLMFTYCGELLSRHSIRSGDAFWRGAWWKHAHFIRQDILIFLVNSRRAVHVTAGKF 433
            |::.:.|.::.:..|.|..|:.|:....::.:...|.:::...|:.:..::...:|.|.|.||.|
  Fly   292 QFVAVMIVQIFLPCYYGNELTFHANALTNSVFGTNWLEYSVGTRKLLNCYMEFLKRPVKVRAGVF 356

  Fly   434 YVMDVNRLRSVITQAFSFLTLLQKLA 459
            :.:.:......|..|:||..||.|::
  Fly   357 FEIGLPIFVKTINNAYSFFALLLKIS 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85eNP_001262374.1 7tm_6 120..449 CDD:251636 74/356 (21%)
Or94bNP_524456.1 7tm_6 66..372 CDD:251636 77/383 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.