DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85e and Or94a

DIOPT Version :9

Sequence 1:NP_001262374.1 Gene:Or85e / 41018 FlyBaseID:FBgn0026399 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_524455.1 Gene:Or94a / 42711 FlyBaseID:FBgn0039033 Length:387 Species:Drosophila melanogaster


Alignment Length:396 Identity:85/396 - (21%)
Similarity:149/396 - (37%) Gaps:76/396 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LHLGVLFT---KTTLDVLPTGELQAITDALTMTI--------IYFFTGYGTIYWCLRSRRLLAYM 128
            |||.:.||   ...|:...:..|:.....|.|:|        |.....|.|..|     ||:..:
  Fly    48 LHLPITFTFIGLMWLEAFISSNLEQAGQVLYMSITEMALVVKILSIWHYRTEAW-----RLMYEL 107

  Fly   129 EHMNREYRHHSLAGVTFVSSHAAFRMSRNFTVVWIMSCLLGVISWGVSPLMLGIRMLPLQCWYPF 193
            :|. .:|:.|:...|.|.....  |..:.|..::|:..|..|.|.....|.|....||...:.||
  Fly   108 QHA-PDYQLHNQEEVDFWRREQ--RFFKWFFYIYILISLGVVYSGCTGVLFLEGYELPFAYYVPF 169

  Fly   194 DALGPGTYTAVYATQLFGQIMVGMTFGFGGSLFVTLSLLLLGQFDVLYCSLKNLDAHTKLLGGES 258
            :......|...|     |..|.|||.    :....::|..||.:.:.:.||.     .:|||   
  Fly   170 EWQNERRYWFAY-----GYDMAGMTL----TCISNITLDTLGCYFLFHISLL-----YRLLG--- 217

  Fly   259 VNGLSSLQEELLLGDSKRELNQYVLLQEHPTDLLRLSAGRKCPDQGNAFHNALVECIRLHRFILH 323
                      |.|.::|...|..:                        |...|.....:|:.|..
  Fly   218 ----------LRLRETKNMKNDTI------------------------FGQQLRAIFIMHQRIRS 248

  Fly   324 CSQELENLFSPYCL----VKSLQITFQLCLLVFVGVSGTREVLRIVNQLQYLGLTIFELLMFTYC 384
            .:...:.:.|||.|    :.:|.|.|....|..||:.....  :.::.||::.:.|.::.:..|.
  Fly   249 LTLTCQRIVSPYILSQIILSALIICFSGYRLQHVGIRDNPG--QFISMLQFVSVMILQIYLPCYY 311

  Fly   385 GELLSRHSIRSGDAFWRGAWWKHAHFIRQDILIFLVNSRRAVHVTAGKFYVMDVNRLRSVITQAF 449
            |..::.::.:..:..:...|.:....||:.:..::.:.::.|.:.||.|:.:.:......|..|:
  Fly   312 GNEITVYANQLTNEVYHTNWLECRPPIRKLLNAYMEHLKKPVTIRAGNFFAVGLPIFVKTINNAY 376

  Fly   450 SFLTLL 455
            |||.||
  Fly   377 SFLALL 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85eNP_001262374.1 7tm_6 120..449 CDD:251636 65/332 (20%)
Or94aNP_524455.1 7tm_6 69..376 CDD:251636 73/367 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.