DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85e and Or88a

DIOPT Version :9

Sequence 1:NP_001262374.1 Gene:Or85e / 41018 FlyBaseID:FBgn0026399 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_524348.2 Gene:Or88a / 41715 FlyBaseID:FBgn0038203 Length:401 Species:Drosophila melanogaster


Alignment Length:426 Identity:90/426 - (21%)
Similarity:153/426 - (35%) Gaps:108/426 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 SMVIF-TSLHLGVLFTKTT-LDVL-------PTGELQAITDALTMTIIYFFTGYGTIYWCLRSRR 123
            |||.| .|..|.|||.... .|::       |..:...:   |::||.:...|. .:|  |:.:.
  Fly    45 SMVPFCLSAFLNVLFFGCNGWDIIGHFWLGHPANQNPPV---LSITIYFSIRGL-MLY--LKRKE 103

  Fly   124 LLAYMEHMNREYRHHSLAGVTFVSSHAAFRMSRNFTVVWIMSCLLGVISWGVSPLMLGI-----R 183
            ::.::..::||.....::.:............:.:..:.|.|.|.|.: :.|.||.|.:     :
  Fly   104 IVEFVNDLDRECPRDLVSQLDMQMDETYRNFWQRYRFIRIYSHLGGPM-FCVVPLALFLLTHEGK 167

  Fly   184 MLP-------LQCWYPFDA-LGPGTYTAVYATQLFGQIMVGMTFGFGGSLFVTLSLLLLGQFDVL 240
            ..|       |..|.|... ..|..|..|::..|       |....|.|.|||        ||.|
  Fly   168 DTPVAQHEQLLGGWLPCGVRKDPNFYLLVWSFDL-------MCTTCGVSFFVT--------FDNL 217

  Fly   241 YCSLKNLDAHTKLLGGESVNGLSSLQEELLLGDSKR---ELNQYVLLQEHPTDLLRLSAGRKCPD 302
            :   ..:..|..:..|......|::.....|.|.||   :|...|..|:....|.|         
  Fly   218 F---NVMQGHLVMHLGHLARQFSAIDPRQSLTDEKRFFVDLRLLVQRQQLLNGLCR--------- 270

  Fly   303 QGNAFHNALVECIRLHRFILHCSQELENLFSPYCLVKSLQITFQLCLLVFVGVSGTREVLRIVNQ 367
                                    :..::|....||.:......||..:|: :|.|.:||.|.  
  Fly   271 ------------------------KYNDIFKVAFLVSNFVGAGSLCFYLFM-LSETSDVLIIA-- 308

  Fly   368 LQYLGLTIFELLMFTY--C--GELLSR------HSIRSGDAFWRGAWWKHAHFIRQDILIFLVNS 422
             ||: |....|:.||:  |  |..|.:      .|:||.:      |:..:...|:..|::....
  Fly   309 -QYI-LPTLVLVGFTFEICLRGTQLEKASEGLESSLRSQE------WYLGSRRYRKFYLLWTQYC 365

  Fly   423 RRAVHVTAGKFYVMDVNRLR--SVITQAFSFLTLLQ 456
            :|...:  |.|.::.||.:.  .::..|:...|.|:
  Fly   366 QRTQQL--GAFGLIQVNMVHFTEIMQLAYRLFTFLK 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85eNP_001262374.1 7tm_6 120..449 CDD:251636 70/356 (20%)
Or88aNP_524348.2 7tm_6 75..392 CDD:251636 77/387 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.