DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85e and Or85f

DIOPT Version :9

Sequence 1:NP_001262374.1 Gene:Or85e / 41018 FlyBaseID:FBgn0026399 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_524289.1 Gene:Or85f / 41119 FlyBaseID:FBgn0037685 Length:392 Species:Drosophila melanogaster


Alignment Length:398 Identity:66/398 - (16%)
Similarity:153/398 - (38%) Gaps:77/398 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 TIYWCL----------RSRRLLAYMEHMNREYRHHSLAGVTFVSSHAAFRMSR-----NFTVVWI 163
            |::|.:          ||||:|.::      ||...||..........|||..     |.:::..
  Fly    17 TVFWIMGYDMLGVPKTRSRRILYWI------YRFLCLASHGVCVGVMVFRMVEAKTIDNVSLIMR 75

  Fly   164 MSCLLGVISWGVSPLMLGIRMLPLQC-------WYPFDALGP---------GTYTAVYATQLF-- 210
            .:.|:..|....:.....::...:|.       .||...|..         .|.:.||...::  
  Fly    76 YATLVTYIINSDTKFATVLQRSAIQSLNSKLAELYPKTTLDRIYHRVNDHYWTKSFVYLVIIYIG 140

  Fly   211 -------GQIMVGMTFGFGGSLFVTLSLLLLGQFDV------LYCSLKNLD-AH-TKLLGGESVN 260
                   |.|:..:...|..::|..:.......:|.      :|.|:..|: .| |:::      
  Fly   141 SSIMVVIGPIITSIIAYFTHNVFTYMHCYPYFLYDPEKDPVWIYISIYALEWLHSTQMV------ 199

  Fly   261 GLSSLQEELLLGDSKRELNQYVLLQEHPTDLLRLSAGRKCP----DQGNAFHNALVECIRLHRFI 321
             :|::..::.|      |...|.:..|...::|..|..| |    ||.:....|.:...::|  :
  Fly   200 -ISNIGADIWL------LYFQVQINLHFRGIIRSLADHK-PSVKHDQEDRKFIAKIVDKQVH--L 254

  Fly   322 LHCSQELENLFSPYCLVKSLQITFQLC-LLVFVGVSGTREVLRIVNQLQYLGLTIFELLMFTYCG 385
            :....:|..:|....|:..|.....:| :.|:..:.|  ..|.....:.::|.::.::.:..|.|
  Fly   255 VSLQNDLNGIFGKSLLLSLLTTAAVICTVAVYTLIQG--PTLEGFTYVIFIGTSVMQVYLVCYYG 317

  Fly   386 ELLSRHSIRSGDAFWRGAWWKHAHFIRQDILIFLVNSRRAVHVTAGKFYVMDVNRLRSVITQAFS 450
            :.:...|.....|.:...:...:...::.:||.::.:::.|.:.|..:..:.::..:.:::.::.
  Fly   318 QQVLDLSGEVAHAVYNHDFHDASIAYKRYLLIIIIRAQQPVELNAMGYLSISLDTFKQLMSVSYR 382

  Fly   451 FLTLLQKL 458
            .:|:|.::
  Fly   383 VITMLMQM 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85eNP_001262374.1 7tm_6 120..449 CDD:251636 62/371 (17%)
Or85fNP_524289.1 7tm_6 68..381 CDD:251636 50/330 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.