DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85e and Or83c

DIOPT Version :9

Sequence 1:NP_001262374.1 Gene:Or85e / 41018 FlyBaseID:FBgn0026399 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_524244.2 Gene:Or83c / 40744 FlyBaseID:FBgn0037399 Length:397 Species:Drosophila melanogaster


Alignment Length:382 Identity:85/382 - (22%)
Similarity:135/382 - (35%) Gaps:108/382 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 YCSMVIFTSLHLGVLFTKTTLDVLPTGELQAITDALTMTIIYFFTGYGTIYWCLRS----RRLLA 126
            |....:||.|:.|..:.......|.||.|              |.|.|....||..    |||:.
  Fly    50 YTGFTVFTILNNGGDWRVGLKASLMTGGL--------------FHGLGKFLTCLLKHQDMRRLVL 100

  Fly   127 YMEHMNREYR-----HHSLAGVTFVSSHAAFRMSRNFTVVWIMSCLLGVISWGVSPLML----GI 182
            |.:.:..||.     :|..............::.||..|  ...||:.::     ||.:    |.
  Fly   101 YSQSIYDEYETRGDSYHRTLNSNIDRLLGIMKIIRNGYV--FAFCLMELL-----PLAMLMYDGT 158

  Fly   183 RMLPLQCWYPFDALGPG-------TYTAVYATQLFGQIMVGMTFGFGGSLFVTLSLLLLGQF-DV 239
            |:..:|      .|.||       .|...|..|....::.|:.| :.|.|||.|.|..:..| |:
  Fly   159 RVTAMQ------YLIPGLPLENNYCYVVTYMIQTVTMLVQGVGF-YSGDLFVFLGLTQILTFADM 216

  Fly   240 LYCSLKNLD------AHTKLL--GGESVNGLSSLQEEL--------LLGDSKRELN--QYVLLQE 286
            |...:|.|:      |..:.|  .|.|::|..:.|..|        |..|..|.:|  .|.|:  
  Fly   217 LQVKVKELNDALEQKAEYRALVRVGASIDGAENRQRLLLDVIRWHQLFTDYCRAINALYYELI-- 279

  Fly   287 HPTDLLRLSAGRKCPDQGNAFHNALVECIRLHRFILHCSQELENLFSP-----YCLVKSL----- 341
             .|.:|.:           |....|..||.|..|  |....:..:.|.     ||::.::     
  Fly   280 -ATQVLSM-----------ALAMMLSFCINLSSF--HMPSAIFFVVSAYSMSIYCILGTILEFAY 330

  Fly   342 -QITFQLCLLVFVGVSGTREVL--------RIVNQLQYLGL------TIFELLMFTY 383
             |:...:|.:.:..:||.:..|        :..:.:|.||:      |..:::...|
  Fly   331 DQVYESICNVTWYELSGEQRKLFGFLLRESQYPHNIQILGVMSLSVRTALQIVKLIY 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85eNP_001262374.1 7tm_6 120..449 CDD:251636 71/328 (22%)
Or83cNP_524244.2 7tm_6 69..387 CDD:251636 79/361 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.