DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85e and Or63a

DIOPT Version :9

Sequence 1:NP_001262374.1 Gene:Or85e / 41018 FlyBaseID:FBgn0026399 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster


Alignment Length:401 Identity:79/401 - (19%)
Similarity:152/401 - (37%) Gaps:76/401 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 DVLPTGE-----LQAITDALTMTIIYFFTGYGTIYWCLRSRRLLAYMEHMNREYRHHSLAGVTFV 146
            |:...||     ||.:|....|.  ||...:..||..||..|....::......|...|..:..:
  Fly    70 DIPRIGETAGTALQFLTSIAKMW--YFLFAHRQIYELLRKARCHELLQKCELFERMSDLPVIKEI 132

  Fly   147 SSHAAFRMSRNFT------VVWIMSCLLGVISWGVSPLMLGIR------------MLPLQCWYPF 193
            .......|:|.:.      ::::.||:....::.::..::.:.            ||||...||.
  Fly   133 RQQVESTMNRYWASTRRQILIYLYSCICITTNYFINSFVINLYRYFTKPKGSYDIMLPLPSLYPA 197

  Fly   194 DALGPGTYTAVYATQLFGQIMVGMTFGFGGSLFVTLSLLLLGQFDVLYCSLKNLDAHTKLLGGES 258
            .. ..|.....|..|::               ..|.||.:.|.     |:: :.|....:|...|
  Fly   198 WE-HKGLEFPYYHIQMY---------------LETCSLYICGM-----CAV-SFDGVFIVLCLHS 240

  Fly   259 VNGLSSLQEELLLGDSKRELNQYVLLQEHPTDLLRLSAGRKCPDQGNAFHNALVECIRLHRFILH 323
            | ||            .|.|||  ::::..::|:.       ||:...:   |..||..::.:.:
  Fly   241 V-GL------------MRSLNQ--MVEQATSELVP-------PDRRVEY---LRCCIYQYQRVAN 280

  Fly   324 CSQELENLFSPYCLVKSLQITFQLCLLVF---VGVSGTREVLRIVNQLQYLGLTIFELLMFTYCG 385
            .:.|:.|.|......:.|...|...|.:|   ||: |....:.::....||....::::::.|.|
  Fly   281 FATEVNNCFRHITFTQFLLSLFNWGLALFQMSVGL-GNNSSITMIRMTMYLVAAGYQIVVYCYNG 344

  Fly   386 ELLSRHSIRSGDAFWRGAWWKHAHFIRQDILIFLVNSRRAVHVTAGKFYVMDVNRLRSVITQAFS 450
            :..:..|....:||::..|:..:...|..|.:.|:.:.|...:....|..|.:..|.:::..:..
  Fly   345 QRFATASEEIANAFYQVRWYGESREFRHLIRMMLMRTNRGFRLDVSWFMQMSLPTLMAMVRTSGQ 409

  Fly   451 FLTLLQKLAAK 461
            :..|||.:..|
  Fly   410 YFLLLQNVNQK 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85eNP_001262374.1 7tm_6 120..449 CDD:251636 63/349 (18%)
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 73/381 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.