DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85e and Or56a

DIOPT Version :9

Sequence 1:NP_001262374.1 Gene:Or85e / 41018 FlyBaseID:FBgn0026399 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_523796.2 Gene:Or56a / 37269 FlyBaseID:FBgn0034473 Length:419 Species:Drosophila melanogaster


Alignment Length:325 Identity:63/325 - (19%)
Similarity:135/325 - (41%) Gaps:68/325 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 SRNFT-VVWIMSCLLGVISWGVSPLMLGIRMLPLQCWYPFDALGPGTYTAVYATQL--FGQIMVG 216
            :|..| ::||.|.:.|::::  |..:.....|| :..:...|:..|....:...||  ||::...
  Fly   135 TRTITLLIWIPSVIAGLMAY--SDCIYRSLFLP-KSVFNVPAVRRGEEHPILLFQLFPFGELCDN 196

  Fly   217 MTFGFGGSLFVTLSLLLLGQFDV------LYCSLKNLDAHTKLLGG--ESVNGLSSLQEELLLGD 273
            ...|:.|..:.    |.||...:      :.|.:|.::...::|..  |.:: ::.|..:|::| 
  Fly   197 FVVGYLGPWYA----LGLGITAIPLWHTFITCLMKYVNLKLQILNKRVEEMD-ITRLNSKLVIG- 255

  Fly   274 SKRELNQYVLLQEHPTDLLRLSAGRKCPDQGNAFHNALVECIRLHRFILHCSQELENLFSPYCLV 338
                               ||:|......|...|...:.|.:|:.:|:    |||:.|.....:.
  Fly   256 -------------------RLTASELTFWQMQLFKEFVKEQLRIRKFV----QELQYLICVPVMA 297

  Fly   339 KSLQITFQLCLLVFVGVSGTREVLRIVNQLQYLGLTIFELLMFTYCGELLSRH-----SIRSGD- 397
            ..:..:..:|.|.|....|      :.:::.|..:.|:   :|...|.|...|     .:...| 
  Fly   298 DFIIFSVLICFLFFALTVG------VPSKMDYFFMFIY---LFVMAGILWIYHWHATLIVECHDE 353

  Fly   398 ---AFWRGAWWKHAHFIRQDILIFLVNSRRAVHVTAGKFYVMDVNRLRSVI---TQAFSFLTLLQ 456
               |::...|:.....:::.::..:::::|.:.:.|   .::|:| ||:.|   ..|:|:..||:
  Fly   354 LSLAYFSCGWYNFEMPLQKMLVFMMMHAQRPMKMRA---LLVDLN-LRTFIDIGRGAYSYFNLLR 414

  Fly   457  456
              Fly   415  414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85eNP_001262374.1 7tm_6 120..449 CDD:251636 59/316 (19%)
Or56aNP_523796.2 7tm_6 126..407 CDD:251636 59/316 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.