DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85e and Or49a

DIOPT Version :9

Sequence 1:NP_001262374.1 Gene:Or85e / 41018 FlyBaseID:FBgn0026399 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster


Alignment Length:475 Identity:74/475 - (15%)
Similarity:161/475 - (33%) Gaps:131/475 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SNLFRLLMGLQLANGTKPSPRLPKWWPKRLEMIGKVLPKAY---CSMVIFTSLHLGVLFTKTTLD 87
            :|:....:|..|.:..||      ||       ..:|.:.|   |::..|....:      .|..
  Fly    14 ANMMFKTLGYDLFHTPKP------WW-------RYLLVRGYFVLCTISNFYEASM------VTTR 59

  Fly    88 VLPTGELQAITDALTMTIIYFFTGYGT----IYWCLRSRRLLAYMEHMNREYRHHSLAGVTF-VS 147
            ::....|......:....::||....:    |.:.:..:|||.....:...|.|.......: |:
  Fly    60 IIEWESLAGSPSKIMRQGLHFFYMLSSQLKFITFMINRKRLLQLSHRLKELYPHKEQNQRKYEVN 124

  Fly   148 SHAAFRMSRNFTVVW------------IMSCLLGVISWGVSPLMLGIRMLPLQCWYPFDALGPGT 200
            .:.....:||...|:            :.||::.:|.:|.:..... |:.|.:  ..||:..|..
  Fly   125 KYYLSCSTRNVLYVYYFVMVVMALEPLVQSCIMYLIGFGKADFTYK-RIFPTR--LTFDSEKPLG 186

  Fly   201 YTAVYATQL-FGQIMVGMTFGFGGSLFVTLSLLLLGQFDV-LYCSLKNLDAHTKLLGGESVNGLS 263
            |...|.... :.|.:|.::.|                .|: :.|....:..|.    |...|.|:
  Fly   187 YVLAYVIDFTYSQFIVNVSLG----------------TDLWMMCVSSQISMHL----GYLANMLA 231

  Fly   264 SLQEELLLGDSKRELNQYVLLQEHPTDLLRLSAGRKCPDQGNAFHNALVECIRLHRFILHCSQEL 328
            |:                                |..|:......:.|...|:.|:.::...:::
  Fly   232 SI--------------------------------RPSPETEQQDCDFLASIIKRHQLMIRLQKDV 264

  Fly   329 ---------ENLFSPYCLVKSLQITFQLCLLVFVGVSGTREVLRIVNQLQYLGLTIFELL----- 379
                     .|||:..||         ||.:.:         ..:|....:.|::...|.     
  Fly   265 NYVFGLLLASNLFTTSCL---------LCCMAY---------YTVVEGFNWEGISYMMLFASVAA 311

  Fly   380 ---MFTYCGELLSRHSIRSGDAFWRGAWWKHAHFIRQDILIFLVNSRRAVHVTAGKFYVMDVNRL 441
               :.:..|::|...|.....|.:...|::.:...:::|||.:..::|.:.::|....::.::..
  Fly   312 QFYVVSSHGQMLIDLSTNLAKAAFESKWYEGSLRYKKEILILMAQAQRPLEISARGVIIISLDTF 376

  Fly   442 RSVITQAFSFLTLLQKLAAK 461
            :.::|..:.|..::::...|
  Fly   377 KILMTITYRFFAVIRQTVEK 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85eNP_001262374.1 7tm_6 120..449 CDD:251636 56/360 (16%)
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 57/368 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.