DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85e and Or47b

DIOPT Version :9

Sequence 1:NP_001262374.1 Gene:Or85e / 41018 FlyBaseID:FBgn0026399 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_523690.3 Gene:Or47b / 36212 FlyBaseID:FBgn0026385 Length:412 Species:Drosophila melanogaster


Alignment Length:474 Identity:93/474 - (19%)
Similarity:165/474 - (34%) Gaps:103/474 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DPARESNLFRLLMGL----QLANGTKPS--PRLPKWWPKR-LEMIGKVLPKAYCSMVIFTSLHLG 78
            |...:|||..|.:.|    .:.....|.  |||..::.:. |.::.:...|...|:.::..::|.
  Fly     3 DSGYQSNLSLLRVFLDEFRSVLRQESPGLIPRLAFYYVRAFLSLLCQYPNKKLASLPLYRWINLF 67

  Fly    79 VLFTKTTL------------DVLPTG-ELQAITD-ALTMTIIYFFTGYGTIYWCLRSRRLLAYME 129
            ::....|:            :|:..| :|..|:. ||..|.|::..     ..|.....|::..|
  Fly    68 IMCNVMTIFWTMFVALPESKNVIEMGDDLVWISGMALVFTKIFYMH-----LRCDEIDELISDFE 127

  Fly   130 HMNREYRHHSLAGVTFVSSHAAFRMSRNFTVVWIMSCLLGVISWGV--SPLMLGIRMLPLQCWYP 192
            :.|||.|.|::...........:.:.....:...  ||:...|..:  .|| ||...||....||
  Fly   128 YYNRELRPHNIDEEVLGWQRLCYVIESGLYINCF--CLVNFFSAAIFLQPL-LGEGKLPFHSVYP 189

  Fly   193 FD----ALGPGTYTAVYATQ-------LFGQIMVGMTFGFGGSLFVTLSLLLLGQFDVLYCSLKN 246
            |.    .|.|.|:..:|..|       |...:||.|.   |.|.|:..:|           :||.
  Fly   190 FQWHRLDLHPYTFWFLYIWQSLTSQHNLMSILMVDMV---GISTFLQTAL-----------NLKL 240

  Fly   247 LDAHTKLLGGESVNGLSSLQEELLLGDSKRELNQYVLLQEHPTDLLRLSAGRKCPDQGNAFHNAL 311
            |....:.||...|:             .||                              ||...
  Fly   241 LCIEIRKLGDMEVS-------------DKR------------------------------FHEEF 262

  Fly   312 VECIRLHRFILHCSQELENLFSPYCLVKSLQITFQL-CLLVFVGVSGTREVLRIVNQLQYLGLTI 375
            ...:|.|:.|:....:....|:. .....|..:|.| .:..|..::......::..:...|.|..
  Fly   263 CRVVRFHQHIIKLVGKANRAFNG-AFNAQLMASFSLISISTFETMAAAAVDPKMAAKFVLLMLVA 326

  Fly   376 F-ELLMFTYCGELLSRHSIRSGD-AFWRGAWWKHAHFIRQDILIFLVNSRRAVHVTAGKFYVMDV 438
            | :|.::...|.|:...|:.... ||....|...:..|::||...::.:::.:...|..|....:
  Fly   327 FIQLSLWCVSGTLVYTQSVEVAQAAFDINDWHTKSPGIQRDISFVILRAQKPLMYVAEPFLPFTL 391

  Fly   439 NRLRSVITQAFSFLTLLQK 457
            .....|:...:..|.|:|:
  Fly   392 GTYMLVLKNCYRLLALMQE 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85eNP_001262374.1 7tm_6 120..449 CDD:251636 66/344 (19%)
Or47bNP_523690.3 7tm_6 88..402 CDD:251636 75/379 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.