DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85e and Or42a

DIOPT Version :9

Sequence 1:NP_001262374.1 Gene:Or85e / 41018 FlyBaseID:FBgn0026399 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_523622.2 Gene:Or42a / 35514 FlyBaseID:FBgn0033041 Length:406 Species:Drosophila melanogaster


Alignment Length:166 Identity:36/166 - (21%)
Similarity:69/166 - (41%) Gaps:11/166 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 HNALVECIRLHRFILHCSQELENLFS----PYCLVKSLQITFQLCLLVFVGVSGTREVLRIVNQL 368
            :..||:||:.|:.||.....|..:.|    ...||..|.:.|.|..:|.....|:     .:..|
  Fly   244 YERLVQCIQDHKVILRFVDCLRPVISGTIFVQFLVVGLVLGFTLINIVLFANLGS-----AIAAL 303

  Fly   369 QYLGLTIFELLMFTYCGELLSRHSIRSGDAFWRGAWWKHAHFIRQDILIFLVNSRRAVHVTAGKF 433
            .::...:.|...|......|:....:..||.::..|.......::.::.||...::.:...|...
  Fly   304 SFMAAVLLETTPFCILCNYLTEDCYKLADALFQSNWIDEEKRYQKTLMYFLQKLQQPITFMAMNV 368

  Fly   434 YVMDVNRLRSVITQAFSFLTLLQK--LAAKKTESEL 467
            :.:.|....||...:||..||:::  ::.|..:||:
  Fly   369 FPISVGTNISVTKFSFSVFTLVKQMNISEKLAKSEM 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85eNP_001262374.1 7tm_6 120..449 CDD:251636 29/144 (20%)
Or42aNP_523622.2 7tm_6 79..384 CDD:251636 29/144 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.