DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85e and Or35a

DIOPT Version :9

Sequence 1:NP_001262374.1 Gene:Or85e / 41018 FlyBaseID:FBgn0026399 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster


Alignment Length:299 Identity:54/299 - (18%)
Similarity:101/299 - (33%) Gaps:73/299 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 YTAVYATQLFGQI----------MVGMTFGFGGS-LFVTLSLLLLGQFDVLYCSLKNLDAHTKLL 254
            |.||.:..|...:          :..|.|.|... |::.:.|||                 |.:.
  Fly   144 YGAVISLYLIAPVFSIINQSKDFLYSMIFPFDSDPLYIFVPLLL-----------------TNVW 191

  Fly   255 GGESVN----GLSSLQEELLLGDSKRELN-QYVLLQEHPTDLL----RLSAGRKCPDQGNAFHNA 310
            .|..::    |.::|..||::     .|| .|:||:.   ||.    ::...|..|.........
  Fly   192 VGIVIDTMMFGETNLLCELIV-----HLNGSYMLLKR---DLQLAIEKILVARDRPHMAKQLKVL 248

  Fly   311 LVECIRLHRFILHCSQELENLFSPYCLVKSLQITFQLCLLVFVGVSGTREVLRIVNQLQYLGLTI 375
            :.:.:|.:..:....|:||..::....:........||.|.|...  |..:...:..: :.|...
  Fly   249 ITKTLRKNVALNQFGQQLEAQYTVRVFIMFAFAAGLLCALSFKAY--TNPMANYIYAI-WFGAKT 310

  Fly   376 FELLMFTYCGELLSRHSIRSGDAFWRGAWWKHAHFIRQDILIFLVNSRR----------AVHVTA 430
            .|||.....|..|:..:......::...|        :.||.:..|...          |:.:.:
  Fly   311 VELLSLGQIGSDLAFTTDSLSTMYYLTHW--------EQILQYSTNPSENLRLLKLINLAIEMNS 367

  Fly   431 GKFYVMDVNRLR-------SVITQAFSFLTLLQKLAAKK 462
            ..|||..:...|       .::..:||:.|.|..:..::
  Fly   368 KPFYVTGLKYFRVSLQAGLKILQASFSYFTFLTSMQRRQ 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85eNP_001262374.1 7tm_6 120..449 CDD:251636 50/284 (18%)
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 50/284 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.