DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85e and Or33c

DIOPT Version :9

Sequence 1:NP_001262374.1 Gene:Or85e / 41018 FlyBaseID:FBgn0026399 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_523555.1 Gene:Or33c / 34603 FlyBaseID:FBgn0026390 Length:384 Species:Drosophila melanogaster


Alignment Length:354 Identity:72/354 - (20%)
Similarity:119/354 - (33%) Gaps:110/354 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 EHMNREYRHHSLAGVTFVSSHAAFRMSRNFTVVWIMSCLLGVISWGV--SPLMLGIRM------- 184
            |..:|.||.|       |..||     |.||     .||  .||:|:  :..:.|:.:       
  Fly   108 EQEHRYYRDH-------VHCHA-----RRFT-----RCL--YISFGMIYALFLFGVFVQVISGNW 153

  Fly   185 -LPLQCWYPFD----------ALGPGTYTAVYATQLFGQIMVGMTFGFGGSLFVTLSLLLLGQFD 238
             |....::|||          |||         .|:|..::.|.. |.|...:..|:|.||.   
  Fly   154 ELLYPAYFPFDLESNRFLGAVALG---------YQVFSMLVEGFQ-GLGNDTYTPLTLCLLA--- 205

  Fly   239 VLYCSLKNLDAHTKLLGGESVNGLSSLQEELLLGDSKRELNQYVLLQEHPTDLLRLSAGRKCPDQ 303
                      .|..|        .|....:|...|.:..:|                        
  Fly   206 ----------GHVHL--------WSIRMGQLGYFDDETVVN------------------------ 228

  Fly   304 GNAFHNALVECIRLHRFILHCSQELENLFSPYCLVKSLQITFQLCLLV-----FVGVSGTREVLR 363
                |..|::.|..|:.::.....:....|...||:.......||::|     |||     :.:.
  Fly   229 ----HQRLLDYIEQHKLLVRFHNLVSRTISEVQLVQLGGCGATLCIIVSYMLFFVG-----DTIS 284

  Fly   364 IVNQLQYLGLTIFELLMFTYCGELLSRHSIRSGDAFWRGAWWKHAHFIRQDILIF--LVNSRRAV 426
            :|..|.:.|:...:|....|....::....|...|.:...|:..:...|.|:|||  |....|..
  Fly   285 LVYYLVFFGVVCVQLFPSCYFASEVAEELERLPYAIFSSRWYDQSRDHRFDLLIFTQLTLGNRGW 349

  Fly   427 HVTAGKFYVMDVNRLRSVITQAFSFLTLL 455
            .:.||....:::|...:.:..|:|...::
  Fly   350 IIKAGGLIELNLNAFFATLKMAYSLFAVV 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85eNP_001262374.1 7tm_6 120..449 CDD:251636 70/346 (20%)
Or33cNP_523555.1 7tm_6 60..372 CDD:251636 70/346 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.