DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85e and Or33b

DIOPT Version :9

Sequence 1:NP_001262374.1 Gene:Or85e / 41018 FlyBaseID:FBgn0026399 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_523554.1 Gene:Or33b / 34602 FlyBaseID:FBgn0026391 Length:379 Species:Drosophila melanogaster


Alignment Length:415 Identity:85/415 - (20%)
Similarity:145/415 - (34%) Gaps:105/415 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 MVIFTSLH--LGVLFTKTTLDVLPTGELQAITDALTMTIIYFFTGYGTIYWCLRSR-RLLAYMEH 130
            :.|:..:|  ||:...::..||         ...|.:|...||..:..|  |.|.: ..:..:|.
  Fly    44 VTIWYPIHLILGLFMERSLGDV---------CKGLPITAACFFASFKFI--CFRFKLSEIKEIEI 97

  Fly   131 MNREYRHHSLAGVTFVSSHAAFRMSRNFTVVW---IMSCLLGVISWGVSPLMLGIRMLPLQCWYP 192
            :.:|....:|:.......:...|...||  :|   |::..|..||...|.|..|...|....|:|
  Fly    98 LFKELDQRALSREECEFFNQNTRREANF--IWKSFIVAYGLSNISAIASVLFGGGHKLLYPAWFP 160

  Fly   193 FDALGPGTYTAVYATQLFGQIMVGMTFGFGG-SLFVTLSLLLLGQFDVLYCSLKNLDAHTKLLGG 256
            :|         |.||:|.  ..:.:|:...| ||.:..:|.......:.:|.:.   .|.:||. 
  Fly   161 YD---------VQATELI--FWLSVTYQIAGVSLAILQNLANDSYPPMTFCVVA---GHVRLLA- 210

  Fly   257 ESVNGLSSLQEELLLGDSKRELNQYVLLQEHPTDLLRLSAGRKCPDQ-----GNAFHNALVECIR 316
                                               :|||...:.|::     |    ..|:|.|.
  Fly   211 -----------------------------------MRLSRIGQGPEETIYLTG----KQLIESIE 236

  Fly   317 LHRFILHCSQELENLFSPYCLVKSLQITFQLCLLVFVGVSGTREVLRIVN---------QLQYLG 372
            .||.::.             :|:.|:.|..:..|.....||....:.:||         .:.|.|
  Fly   237 DHRKLMK-------------IVELLRSTMNISQLGQFISSGVNISITLVNILFFADNNFAITYYG 288

  Fly   373 L----TIFELLMFTYCGELLSRHSIRSGDAFWRGAWWKHAHFIRQDILIFLVNSRRAVHVTAGKF 433
            :    .:.||....|.|.|:|....:...|.:...|........:.:|||:..:...|.:.||..
  Fly   289 VYFLSMVLELFPCCYYGTLISVEMNQLTYAIYSSNWMSMNRSYSRILLIFMQLTLAEVQIKAGGM 353

  Fly   434 YVMDVNRLRSVITQAFSFLTLLQKL 458
            ..:.:|...:.:..|:||.||...|
  Fly   354 IGIGMNAFFATVRLAYSFFTLAMSL 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85eNP_001262374.1 7tm_6 120..449 CDD:251636 67/351 (19%)
Or33bNP_523554.1 7tm_6 61..369 CDD:251636 75/387 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.