DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85e and Or33a

DIOPT Version :9

Sequence 1:NP_001262374.1 Gene:Or85e / 41018 FlyBaseID:FBgn0026399 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_523553.1 Gene:Or33a / 34601 FlyBaseID:FBgn0026392 Length:378 Species:Drosophila melanogaster


Alignment Length:314 Identity:65/314 - (20%)
Similarity:121/314 - (38%) Gaps:66/314 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 SHAAFRMSRNFTVVWIMSCL----LGVISWGVSPLMLGIRMLPLQCWYPFDALGPGTYTAVYATQ 208
            |..|..:|:::.|..|.:.:    .|:.|.|.:.:.||        |:|:|....   .|:|   
  Fly   118 SRVARMLSKSYLVAAISAIITATVAGLFSTGRNLMYLG--------WFPYDFQAT---AAIY--- 168

  Fly   209 LFGQIMVGMTFGF---GGSLFVTLSLLLLGQFDVLYCSLKNLDAHTKLLGGESVNGLSSLQEELL 270
                   .::|.:   |.||.:..:|.......:.:|.   :..|.:||    :..||.:..::.
  Fly   169 -------WISFSYQAIGSSLLILENLANDSYPPITFCV---VSGHVRLL----IMRLSRIGHDVK 219

  Fly   271 LGDSKRELNQYVLLQEHPTDLLRLSAGRKCPDQGNAFHNALVECIRLHRFILHCSQELENLFSPY 335
            |..|           |:...|:          :|...|..|::.|||.|..||.||..:.|.|  
  Fly   220 LSSS-----------ENTRKLI----------EGIQDHRKLMKIIRLLRSTLHLSQLGQFLSS-- 261

  Fly   336 CLVKSLQITFQLCLLVFVGVSGTREVLRIVNQLQYLGLTIFELLMFTYCGELLSRHSIRSGDAFW 400
                .:.|:..|..::|...:....:...|    :....:.||....|.|.|::....:...|.:
  Fly   262 ----GINISITLINILFFAENNFAMLYYAV----FFAAMLIELFPSCYYGILMTMEFDKLPYAIF 318

  Fly   401 RGAWWKHAHFIRQDILIFLVNSRRAVHVTAGKFYVMDVNRLRSVITQAFSFLTL 454
            ...|.|......:.::|.:..:...|::.||....:|::...:.:..|:||.||
  Fly   319 SSNWLKMDKRYNRSLIILMQLTLVPVNIKAGGIVGIDMSAFFATVRMAYSFYTL 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85eNP_001262374.1 7tm_6 120..449 CDD:251636 60/307 (20%)
Or33aNP_523553.1 7tm_6 61..367 CDD:251636 60/307 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.