DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85e and Or23a

DIOPT Version :9

Sequence 1:NP_001262374.1 Gene:Or85e / 41018 FlyBaseID:FBgn0026399 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_523458.3 Gene:Or23a / 33450 FlyBaseID:FBgn0026395 Length:379 Species:Drosophila melanogaster


Alignment Length:330 Identity:65/330 - (19%)
Similarity:119/330 - (36%) Gaps:80/330 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 RHHSLAGVTFVSSHAAFRMSRNFTVVWIMSCLLGVISWGVSPLMLGIRM-LPLQCWYPFDALGPG 199
            ||.::      :.| ..|||:.|.:.:.:..::..:     |.:....: ||:..|:|||  ...
  Fly   112 RHRNM------TEH-LLRMSKLFQITYAVVFIIAAV-----PFVFETELSLPMPMWFPFD--WKN 162

  Fly   200 TYTAVYATQLFGQIMVGMTFG----FGGSLFVTLSLLLLGQFDVLYCSLKNLDAHTKLLGGESVN 260
            :..|.....:|.:|  |..|.    |....|..|.|.|:.:    .|.|                
  Fly   163 SMVAYIGALVFQEI--GYVFQIMQCFAADSFPPLVLYLISE----QCQL---------------- 205

  Fly   261 GLSSLQEELLLGDSKRELNQ-YVLLQEHPTDLLRLSAGRKCPDQGNAFHNALVECIRLHRFILHC 324
                    |:|..|  |:.. |..|:|:..|                    ||.|||....:...
  Fly   206 --------LILRIS--EIGYGYKTLEENEQD--------------------LVNCIRDQNALYRL 240

  Fly   325 SQELENLFSPYCLVKSLQITFQLCLLVFVGVSGTREVLRIVNQLQY----LGLTIFELLMFTYCG 385
            ....::|.|...:|:.:.|...:.:.:||.:.   .|..:.:::.|    ||:|: :.....|.|
  Fly   241 LDVTKSLVSYPMMVQFMVIGINIAITLFVLIF---YVETLYDRIYYLCFLLGITV-QTYPLCYYG 301

  Fly   386 ELLSRHSIRSGDAFWRGAWWKHAHFIRQDILIFLVNSRRAVHVTAGKFYVMDVNRLRSVITQAFS 450
            .::.........|.:...|...:...|..:||....::|...:.||....:.::...:....|:|
  Fly   302 TMVQESFAELHYAVFCSNWVDQSASYRGHMLILAERTKRMQLLLAGNLVPIHLSTYVACWKGAYS 366

  Fly   451 FLTLL 455
            |.||:
  Fly   367 FFTLM 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85eNP_001262374.1 7tm_6 120..449 CDD:251636 60/322 (19%)
Or23aNP_523458.3 7tm_6 59..365 CDD:251636 60/322 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.