DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85e and Or22a

DIOPT Version :10

Sequence 1:NP_001262374.1 Gene:Or85e / 41018 FlyBaseID:FBgn0026399 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_523453.1 Gene:Or22a / 33335 FlyBaseID:FBgn0026398 Length:397 Species:Drosophila melanogaster


Alignment Length:179 Identity:39/179 - (21%)
Similarity:73/179 - (40%) Gaps:31/179 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 LRLSAGRKCPDQGNAFHNALVECIRLHRFILHCSQELENLFSPYCLVKSLQITFQLCLLVFVGVS 356
            ||...||    ..:.:...|.||||.||.:|.....|..:||....|:.|.|             
  Fly   229 LRSKPGR----TEDEYLEELTECIRDHRLLLDYVDALRPVFSGTIFVQFLLI------------- 276

  Fly   357 GTREVLRIVNQLQYLG---------LTIFELLM----FTYCGELLSRHSIRSGDAFWRGAWWKHA 408
            ||...|.::| |.:..         |.:|::.|    |.|...::........:..::..|....
  Fly   277 GTVLGLSMIN-LMFFSTFWTGVATCLFMFDVSMETFPFCYLCNMIIDDCQEMSNCLFQSDWTSAD 340

  Fly   409 HFIRQDILIFLVNSRRAVHVTAGKFYVMDVNRLRSVITQAFSFLTLLQK 457
            ...:..::.||.|.::.:.:|||..:.:.:....:::..|||.:|::::
  Fly   341 RRYKSTLVYFLHNLQQPITLTAGGVFPISMQTNLAMVKLAFSVVTVIKQ 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85eNP_001262374.1 7tm_6 120..449 CDD:251636 35/169 (21%)
Or22aNP_523453.1 7tm_6 81..381 CDD:251636 35/169 (21%)

Return to query results.
Submit another query.