DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85e and Or9a

DIOPT Version :9

Sequence 1:NP_001262374.1 Gene:Or85e / 41018 FlyBaseID:FBgn0026399 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_511107.1 Gene:Or9a / 31975 FlyBaseID:FBgn0030204 Length:392 Species:Drosophila melanogaster


Alignment Length:464 Identity:74/464 - (15%)
Similarity:155/464 - (33%) Gaps:134/464 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 MGLQLANGTKPSPRLPKWWPKRLEMIGKVLPKAYCSMVIFTSLHLGVLFTKTTLDVLP------- 90
            ||:.|.:.|..:.|  .|                     .|.:.:|.||    |.::|       
  Fly    27 MGIDLWSPTMANDR--PW---------------------LTFVTMGPLF----LFMVPMFLAAHE 64

  Fly    91 -TGELQAITDALTMTIIYFFTGYGTIYWCLRSRRLLAYMEHMN-------------REYRHHSLA 141
             ..::..::|.|..|.....|....:.:|...:..:..:.|:.             ||       
  Fly    65 YITQVSLLSDTLGSTFASMLTLVKFLLFCYHRKEFVGLIYHIRAILAKEIEVWPDARE------- 122

  Fly   142 GVTFVSSHAAFRMSRNFTVVWIMSCLLGVISWGVSPLMLGIR------MLPLQCWYPFDALGPGT 200
             :..|.:.:...:|..:|..:.::.:...:...|..::..||      .||....||:|......
  Fly   123 -IIEVENQSDQMLSLTYTRCFGLAGIFAALKPFVGIILSSIRGDEIHLELPHNGVYPYDLQVVMF 186

  Fly   201 YTAVYATQLFGQIMVGMTFGFGGSLFVTLSLL---LLGQFDVLYCSLKNLDAHTKLLGGESVNGL 262
            |...|...:......           ||::|.   ||..|....|::..:..| :::...:|.| 
  Fly   187 YVPTYLWNVMASYSA-----------VTMALCVDSLLFFFTYNVCAIFKIAKH-RMIHLPAVGG- 238

  Fly   263 SSLQEELLLGDSKRELNQYVLLQEHPTDLLRLSAGRKCPDQGNAFHNALVECIRLHRFILHCSQE 327
               :|||                                       ..||:.:.||:..|..:..
  Fly   239 ---KEEL---------------------------------------EGLVQVLLLHQKGLQIADH 261

  Fly   328 LENLFSPYCLVKSLQITFQLCLLVFVGVSGTREVLRIVNQLQ------YLGLTIFELLMFTYCGE 386
            :.:.:.|...::......|:|.:.|       :|..:....|      ::|..:..|.:::.|||
  Fly   262 IADKYRPLIFLQFFLSALQICFIGF-------QVADLFPNPQSLYFIAFVGSLLIALFIYSKCGE 319

  Fly   387 LLSRHSIRSGDAFWRGAWWKHAHFIRQDILIFLVNSRRAVHVTAGKFYVMDVNRLRSVITQAFSF 451
            .:...|:..|:..:...|...:...::.:||..:.::|...: .|.|:...:....:::..|.|:
  Fly   320 NIKSASLDFGNGLYETNWTDFSPPTKRALLIAAMRAQRPCQM-KGYFFEASMATFSTIVRSAVSY 383

  Fly   452 LTLLQKLAA 460
            :.:|:...|
  Fly   384 IMMLRSFNA 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85eNP_001262374.1 7tm_6 120..449 CDD:251636 53/356 (15%)
Or9aNP_511107.1 7tm_6 68..381 CDD:251636 58/383 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.