DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85e and Or82a

DIOPT Version :9

Sequence 1:NP_001262374.1 Gene:Or85e / 41018 FlyBaseID:FBgn0026399 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_730794.1 Gene:Or82a / 318778 FlyBaseID:FBgn0041621 Length:385 Species:Drosophila melanogaster


Alignment Length:410 Identity:70/410 - (17%)
Similarity:156/410 - (38%) Gaps:107/410 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 CSMVIFTSLHLGVLFTKTTLDVLPTGELQAITDALTMTIIYFFTGYGTIYWCLRSRRLLAYMEHM 131
            |..|:||::                           :|:|...|       .|.:|:....|.|.
  Fly    64 CLSVVFTNM---------------------------LTVIKIST-------FLANRKDFWEMIHR 94

  Fly   132 NREYRHHSLA-------GVTFVSSHAAFRMSRNFTVVWIMSCLLGVISWGVSPLM-LGI------ 182
            .|:....|.:       |:.:|:.  |.:::......:.:||.|..:.:.:.|:: :|:      
  Fly    95 FRKMHEQSASHIPRYREGLDYVAE--ANKLASFLGRAYCVSCGLTGLYFMLGPIVKIGVCRWHGT 157

  Fly   183 ---RMLPLQCWYPFDAL-GPGTYTAVYATQLFGQIMVGMTFGFGGSLFVTLSLLLLGQFDVLYCS 243
               :.||:...:||:.| .||.......|.|...::|.......| ||::.::            
  Fly   158 TCDKELPMPMKFPFNDLESPGYEVCFLYTVLVTVVVVAYASAVDG-LFISFAI------------ 209

  Fly   244 LKNLDAHTKLLGGESVNGLSSLQEELLLGDSKRELNQYVLLQEHPTDLLRLSAGRKCPDQGNAFH 308
              ||.||.:.|                    :|::..:......|...:||.:            
  Fly   210 --NLRAHFQTL--------------------QRQIENWEFPSSEPDTQIRLKS------------ 240

  Fly   309 NALVECIRLHRFILHCSQELENLFSPYCLVKSLQITFQLCLLVFVGVSGTREVLRIVNQLQYLGL 373
                 .:..|..:|..|::|.::::|..:.:.:..:.|:.::::..|:....|:.::....:.|.
  Fly   241 -----IVEYHVLLLSLSRKLRSIYTPTVMGQFVITSLQVGVIIYQLVTNMDSVMDLLLYASFFGS 300

  Fly   374 TIFELLMFTYCGELLSRHSIRSGDAFWRGAWWKHAHFIRQDILIFLVNSRRAVHVTAGKFYVMDV 438
            .:.:|.::.|.||::...|::...|.....|...:...|..:.:.::.|::.|.:.|| |:|..:
  Fly   301 IMLQLFIYCYGGEIIKAESLQVDTAVRLSNWHLASPKTRTSLSLIILQSQKEVLIRAG-FFVASL 364

  Fly   439 NRLRSVITQAFSFLTLLQKL 458
            .....:...|.|.:||::.:
  Fly   365 ANFVGICRTALSLITLIKSI 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85eNP_001262374.1 7tm_6 120..449 CDD:251636 58/346 (17%)
Or82aNP_730794.1 7tm_6 65..374 CDD:251636 65/397 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.