DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85e and Or65a

DIOPT Version :9

Sequence 1:NP_001262374.1 Gene:Or85e / 41018 FlyBaseID:FBgn0026399 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_729161.1 Gene:Or65a / 318011 FlyBaseID:FBgn0041625 Length:417 Species:Drosophila melanogaster


Alignment Length:417 Identity:81/417 - (19%)
Similarity:144/417 - (34%) Gaps:108/417 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 EMIGKVL----PKAYCSMVIFTSLHLGVLFTKTTLDVLPTGELQAITDALTMTIIYFFTGYGTIY 116
            |.||.::    ...:...:||....| |.|.:.      .|||..|.|||  ..||        :
  Fly    87 ESIGDIVNLGRDLVFIITIIFICFRL-VFFAQY------AGELDVIIDAL--EDIY--------H 134

  Fly   117 WCLRSRRLLAYMEHMNREYRHHSLAGVTFVSSHAAFRMSRNFTVVWIMSCLLGVISWGVSPLMLG 181
            |.::........|.....:.......:|:.|....|.:.:..|..||.|                
  Fly   135 WSIKGPATKEVQETKRLHFLLFMALIITWFSFLILFMLIKISTPFWIES---------------- 183

  Fly   182 IRMLPLQCWYPFDALGPGTYTAVY--------ATQLFGQIMVGMTFGFGGSLFVTLSLLLLGQFD 238
             :.||....:||....|..:...|        .|.|:..|.:|:....|.|||..|:..|    .
  Fly   184 -QTLPFHVSWPFQLHDPSKHPIAYIIIFVSQSTTMLYFLIWLGVVENMGVSLFFELTSAL----R 243

  Fly   239 VLYCSLKNLDAHTKLLGGESVNGLSSLQEELLLGDSKRELNQYVLLQEHPTDLLRLSAGRKCPDQ 303
            ||...|:||                   :||.|||.               |:|           
  Fly   244 VLCIELRNL-------------------QELCLGDE---------------DML----------- 263

  Fly   304 GNAFHNALVECIRLHRFILHCSQELENLFSPYCLVKSLQITFQLCLLVFVGVSGTREVLRI-VNQ 367
                :..|....:.|:.|:..:....::|:...:::.| |.|.|..|....|...::..:: |..
  Fly   264 ----YRELCRMTKFHQQIILLTDRCNHIFNGAFIMQML-INFLLVSLSLFEVLAAKKNPQVAVEY 323

  Fly   368 LQYLGLTIFELLMFTYCGELLSRHS----IRSGDAFWRGAWWKHAHFIRQDILIFLVNSRRAVHV 428
            :..:.:|:..|..::..|::.|:.|    :...:|:......|..|   :....|:..:::.:.:
  Fly   324 MIIMLMTLGHLSFWSKFGDMFSKESEQVALAVYEAYDPNVGSKSIH---RQFCFFIQRAQKPLIM 385

  Fly   429 TAGKFYVMDVNRLRSVITQAFSFLTLL 455
            .|..|...::.....::.|.:|.||:|
  Fly   386 KASPFPPFNLENYMFILKQCYSILTIL 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85eNP_001262374.1 7tm_6 120..449 CDD:251636 59/341 (17%)
Or65aNP_729161.1 7tm_6 145..406 CDD:251636 59/334 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.