DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85e and GPROR8

DIOPT Version :9

Sequence 1:NP_001262374.1 Gene:Or85e / 41018 FlyBaseID:FBgn0026399 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_321153.1 Gene:GPROR8 / 1281214 VectorBaseID:AGAP001912 Length:399 Species:Anopheles gambiae


Alignment Length:303 Identity:63/303 - (20%)
Similarity:121/303 - (39%) Gaps:66/303 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 FTVVWIMSCLLGVISWGVSPLMLGIRMLPLQCWYPFDALGPGTYTAVYATQLFGQIMVGMTFGFG 222
            |.::.::|.:.|.:|.|.     ..:.||...||.:|...||.:...:..|.:|..:..:.:...
Mosquito   152 FNLLPLVSMVAGYVSDGT-----WHKQLPYFMWYWYDWHRPGYFAVTFLHQNWGGFVSAVFYLST 211

  Fly   223 GSLFVTLSLLLLGQFDVLYCSLKNLDAHTKLLGGESVNGLSSLQEELLLGDSKRELNQYVLLQEH 287
            ..:|..:.|||..|||::                                       .|.|....
Mosquito   212 DLMFCAIVLLLCLQFDIV---------------------------------------AYRLSHAL 237

  Fly   288 PTDLLRLSAGRKCPDQGNAFHNALVECIRLHRFILHCSQELENLFSPYCLVKSLQITFQLCLLVF 352
            |.|                 |..||.|:|:|:.::....|||::|||..||..|..:..:||:.|
Mosquito   238 PDD-----------------HQELVGCVRIHQAVIELCNELEHMFSPSLLVNFLSSSVIICLVGF 285

  Fly   353 VGVSG--TREVLRIVNQLQYLGLTIFELLMFTYCGELLSRHSIRSGDAFWRGAWWKHAHFIRQDI 415
            ...:|  ..::.:.|   .:|..::.::.:..|.|..|...|.:...:.:.|.|...:...::.:
Mosquito   286 QATAGITPADLFKFV---LFLVSSLVQVFLLCYYGNKLIVASSQIPYSAFEGNWIGASVSYQRSL 347

  Fly   416 LIFLVNSRRAVHVTAGKFYVMDVNRLRSVITQAFSFLTLLQKL 458
            |..::.|.....:||.||.::.:.....:::.:||:.|||:.:
Mosquito   348 LFVMLRSTTVQKLTALKFSIVSLASYSKILSTSFSYFTLLKAM 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85eNP_001262374.1 7tm_6 120..449 CDD:251636 58/292 (20%)
GPROR8XP_321153.1 7tm_6 77..381 CDD:251636 58/292 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.