DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85e and GPROR72

DIOPT Version :9

Sequence 1:NP_001262374.1 Gene:Or85e / 41018 FlyBaseID:FBgn0026399 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_318786.1 Gene:GPROR72 / 1279115 VectorBaseID:AGAP009718 Length:388 Species:Anopheles gambiae


Alignment Length:437 Identity:80/437 - (18%)
Similarity:154/437 - (35%) Gaps:121/437 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 GKVLPKAYCSMVIFTSLHLGVLFTKT--TLDVLPTGELQAITDALTM-----TIIYFFTGYGTIY 116
            ||.:|.:|     :.|.|:.|.|..|  ||.......:..:...:||     ..|.||.|:.   
Mosquito    30 GKFVPASY-----YVSFHITVYFVSTVWTLRKYIDDPIHMMKVLITMGTAVQLYIKFFVGHS--- 86

  Fly   117 WCLRSRRLLAYMEHMNRE----YRHHSLAGVTFVSSHAAFRMSRNFTVVWIM------SCLLGVI 171
               :::.::.....:.::    |::.|...:..        :.|...::||:      |.:...:
Mosquito    87 ---KAQEIMLVTAELEQQVLKRYQNGSEQEIAV--------LRRTGRILWIVYRMMSASYIFAAV 140

  Fly   172 SWGVSP----LMLGIRMLPLQCW-YPF----DALGPGTYTAVYATQLFGQIMVGMTFGFGGSL-- 225
            ::|:.|    ...|: ::||..: .||    .:||       ||..:..||.: :..|..|::  
Mosquito   141 AFGLYPAFYYFATGV-VVPLFLYELPFFDLSSSLG-------YAVTMCFQINL-LAIGVLGAILS 196

  Fly   226 ---FVTLSLLLLGQFDVLYCSLKNLDAHTKLLGGESVNGLSSLQEELLLGDSKRELNQYVLLQEH 287
               |...::..:.:.|:....|:.|                   |.:|...||.|        ||
Mosquito   197 DFVFFMYAMYAMARADISIVHLREL-------------------ENILNNPSKNE--------EH 234

  Fly   288 PTDLLRLSAGRKCPDQGNAFHNALVECIRLHRFILHCSQELENLFSPYCLVKSLQITFQLC---L 349
            ..:|                .:..|:|:..|:........:||:|...||.:....|..:|   |
Mosquito   235 SAEL----------------RHKWVQCMHDHQQSTSFFSTIENIFGLMCLAQVATATLSICDAML 283

  Fly   350 LVFVGVSGTREVLRIVNQLQYLGLTIFELLMFTYCGELLSRHSIRSGDAFWRG----AWWKHAHF 410
            ||.        :........||.:...:|..|...|.|:....    ||.:..    .|:|....
Mosquito   284 LVL--------LTDWYPTYSYLYVMFVQLSGFFVIGHLVELKI----DAMYNKIISMPWYKLPLK 336

  Fly   411 IRQDILIFLVNSRRAVHVTAGKFYVMDVNRLRSVITQAFSFLTLLQK 457
            .:::....:...:..:.:||..|:.|:.....||:...:.|..::.:
Mosquito   337 EQKEFRFLMSRQQCPMILTAYGFHPMNFEAYMSVLKVLYQFFVMIMQ 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85eNP_001262374.1 7tm_6 120..449 CDD:251636 62/359 (17%)
GPROR72XP_318786.1 7tm_6 60..375 CDD:251636 68/392 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.