DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85e and GPROR48

DIOPT Version :9

Sequence 1:NP_001262374.1 Gene:Or85e / 41018 FlyBaseID:FBgn0026399 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_316697.1 Gene:GPROR48 / 1277251 VectorBaseID:AGAP006666 Length:397 Species:Anopheles gambiae


Alignment Length:178 Identity:43/178 - (24%)
Similarity:91/178 - (51%) Gaps:14/178 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 LLQEHPTDLLRLSAGRKCPDQGNAFHNALVECIRLHRFILHCSQELENLFSPYCLVKSLQITFQL 347
            |||::.    |.|||.....:    |..|.:.::||...:.|::.|:::.|...|::.:.....|
Mosquito   231 LLQQYD----RESAGGLLAQK----HRRLQQIVQLHYRAIECTKLLDSILSLILLIQCVGCLLML 287

  Fly   348 CLLVFVGVSGTR-EVLRIVNQLQYLGLTIF-ELLMFTYCGELLSRHSIRSGDAFWRGAWWKHAHF 410
            ||::|.   .|| ..|.::| :..|.::|| |::.|:|.|..|:..:.....:.:...|:.....
Mosquito   288 CLMLFY---ITRNHSLNVIN-IAVLLMSIFIEMMCFSYLGNQLTEENANISHSAFNCRWYDEPIV 348

  Fly   411 IRQDILIFLVNSRRAVHVTAGKFYVMDVNRLRSVITQAFSFLTLLQKL 458
            ||:..|..::.:.|...:||||||.:::.....:|..::::..:::::
Mosquito   349 IRKYFLRIILQAHRKATITAGKFYNVNIVTFAQLIKTSYTYYMIMKEM 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85eNP_001262374.1 7tm_6 120..449 CDD:251636 43/167 (26%)
GPROR48XP_316697.1 7tm_6 63..387 CDD:251636 43/167 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.