DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85e and GPROR45

DIOPT Version :9

Sequence 1:NP_001262374.1 Gene:Or85e / 41018 FlyBaseID:FBgn0026399 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_311816.1 Gene:GPROR45 / 1272899 VectorBaseID:AGAP003053 Length:383 Species:Anopheles gambiae


Alignment Length:434 Identity:95/434 - (21%)
Similarity:148/434 - (34%) Gaps:138/434 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 KWWPKRLEMIGKVLPKAYCSMVIFTSLHLGVLFTKTTLDVLPTGELQAITDALTMTIIYFFTGYG 113
            |.:..|.|.:.:||..|.|...:|..::. .||.:.....:    :|.:.|            ..
Mosquito    60 KVYRTRFETLLEVLSVAGCGWQMFFRMYF-YLFQQDRCRQI----VQEVRD------------QR 107

  Fly   114 TIYWCLRSRRLLAYMEHMNREYRHHSLAGVTFVSSHAAFRMSRNFTVVWIMSCLLGVISWGVS-- 176
            |:|...|:.|    ||.:.|       ||..        ||...:.|:.:|        :|.|  
Mosquito   108 TVYGADRNPR----MEKLFR-------AGTK--------RMLLAYRVIHLM--------YGTSYF 145

  Fly   177 ----PLMLGIR---MLPLQCWYPFDALGPGT----YTAVYATQLFGQIMVGMTFGFGGSLFVTLS 230
                ||::...   .|||....||  |.|..    |...||..|               |..|:.
Mosquito   146 FQLGPLIMPDPHKCNLPLALQLPF--LPPDRNMVYYCINYAHHL---------------LLNTIG 193

  Fly   231 LLLLGQFD-VLYCSLKNLDAHTKLLGGESVNGLSSLQEELLLGDSK-------------RELNQY 281
            :.:|...| ||..:|.|:...        :..|..|.|||   |:|             .|||:.
Mosquito   194 VFILLPMDGVLIVALLNICTR--------IAALQLLLEEL---DAKLGTVQWQQTAHLDAELNRI 247

  Fly   282 VLLQEHPTDLLRLSAGRKCPDQGNAFHNALVECIRLHRFILHCSQELENLFSPYCLVKSLQITFQ 346
            :.|.   .|..|             |...:.|..::|.|         ::||..|        |.
Mosquito   248 IELH---IDTKR-------------FARVIYETYQMHFF---------SMFSVLC--------FV 279

  Fly   347 LCLLVFVGVSGTREVLRIVNQLQYLGLTIFELLMFTYCGELLSRHSIRSGDAFWRGAWWKHAHFI 411
            :|:.:.|.....|..| |...|...|    :|.:....|.:|...|.|..|:.: |..|......
Mosquito   280 ICMCMNVVARDPRSTL-IPFGLASTG----QLFVICMLGNVLYIVSDRLKDSVY-GIRWYRCTVS 338

  Fly   412 RQDILIFLVNSRRAVHVTAGKFYVMDVNRLRSVITQAFSFLTLL 455
            :|..|:||:.:.:...|....|..:.:....::|..|:|:.|:|
Mosquito   339 QQKRLMFLLANAQPEIVMGAVFIPVTMTSFVTIIRAAYSYFTIL 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85eNP_001262374.1 7tm_6 120..449 CDD:251636 77/355 (22%)
GPROR45XP_311816.1 7tm_6 66..376 CDD:251636 89/420 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.