DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 5-HT2B and Octbeta1R

DIOPT Version :9

Sequence 1:NP_001262373.1 Gene:5-HT2B / 41017 FlyBaseID:FBgn0261929 Length:947 Species:Drosophila melanogaster
Sequence 2:NP_001262843.1 Gene:Octbeta1R / 42652 FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster


Alignment Length:356 Identity:91/356 - (25%)
Similarity:156/356 - (43%) Gaps:92/356 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 NATGN-ATISATFEDV----------------PFDANNYWALLAL------VLVLGTAAGNILVC 95
            :|.|: ::|:.:.|||                ..|.:::.||:.:      .::|....||:||.
  Fly    65 SAVGSGSSIAVSVEDVVAGQAQDIQASEGSTDDADGSSHLALVFVKCFIIGFIILAAILGNMLVI 129

  Fly    96 LAIAWERRLQNVTNYFLMSLAITDLMVAVLVMPLGILTLVKGYFPLGSEHCLTWICLDVLFCTAS 160
            :::...|:|:.:||||::|||:.|::||:..|......::.|.:..||..|..|...||.|.|||
  Fly   130 VSVMRHRKLRIITNYFVVSLAVADMLVALCAMTFNASVMISGKWMFGSVMCDMWNSFDVYFSTAS 194

  Fly   161 IMHLCTISVDRYLSLRYPMRFGRNKTRRRVTLKIVFVWLLSIAMS-LPL---------SLMYSKN 215
            |||||.||||||.::..|:.:....|:|||.:.::.|||....:| ||:         :..|.|:
  Fly   195 IMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPALLSFLPICSGWYTTTENYKYLKS 259

  Fly   216 HASVLVNGTCQIP-DPVYKLVGSIVCFYIPLGVMLLTYCLTVRLLARQRQNLGGGQQTAAATPGW 279
            :..:     |:.. :..|.:|.|.:.|:|| |:::|:....:...|.:::.|....:.||.    
  Fly   260 NPHI-----CEFKVNKAYAIVSSSMSFWIP-GIVMLSMYYRIYQEADRQERLVYRSKVAAL---- 314

  Fly   280 ASGWLGQAPALERRCTWRRLLKPGPGNASSVLHAHSANSTDTDLSTLDNHE-------------- 330
                     .||:.....::.||.|          |.....:.:||:....              
  Fly   315 ---------LLEKHLQISQIPKPRP----------SIQVEQSTISTMRRERKAARTLGIIMSAFL 360

  Fly   331 -LWLP-----------DSSIKEPTPTTMTAL 349
             .|||           ||.|   ||..:..:
  Fly   361 ICWLPFFLWYIVSSLCDSCI---TPRLLVGI 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
5-HT2BNP_001262373.1 7tm_1 90..>262 CDD:278431 62/182 (34%)
7tm_4 90..>238 CDD:304433 55/158 (35%)
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433 45/118 (38%)
7tm_1 124..404 CDD:278431 81/297 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460674
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.