DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 5-HT2B and Dop1R1

DIOPT Version :9

Sequence 1:NP_001262373.1 Gene:5-HT2B / 41017 FlyBaseID:FBgn0261929 Length:947 Species:Drosophila melanogaster
Sequence 2:NP_001262563.1 Gene:Dop1R1 / 41726 FlyBaseID:FBgn0011582 Length:560 Species:Drosophila melanogaster


Alignment Length:351 Identity:112/351 - (31%)
Similarity:169/351 - (48%) Gaps:69/351 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SLGAYNDSGGDDWSSSEHLVLWEEDETQRTTANA--------------------TSRHNQLHVAR 52
            ::|..:.||...:|::..|:..:....|.|||..                    ||.:|:   :.
  Fly    44 TIGGNHTSGSTGFSTNSTLLDADHLPLQLTTAKVDLDIEIDIQLLTNGYDGTTLTSFYNE---SS 105

  Fly    53 W-NATGNATISATFEDVPFDANNYWALLAL--------VLVLGTAAGNILVCLAIAWERRLQNVT 108
            | ||:...||... |..|.      :|:::        ||:..:.||||||||||..||.|:.:.
  Fly   106 WTNASEMDTIVGE-EPEPL------SLVSIVVVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIG 163

  Fly   109 NYFLMSLAITDLMVAVLVMPLGILTLVKGYFPLGSEHCLTWICLDVLFCTASIMHLCTISVDRYL 173
            |.||.||||.||.||.|||....:..:.||:..|::.|.||:..||:..||||::||.||:|||:
  Fly   164 NLFLASLAIADLFVASLVMTFAGVNDLLGYWIFGAQFCDTWVAFDVMCSTASILNLCAISMDRYI 228

  Fly   174 SLRYPMRFGRNKTRRRVTLKIVFVWLLSIAMS-LPLSLMYSKNHASVLV--NG----TCQIP-DP 230
            .::.|:|:||..|||...:.|..:|||:..:| :|:||...:....::.  ||    ||.:. .|
  Fly   229 HIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVPISLGIHRPDQPLIFEDNGKKYPTCALDLTP 293

  Fly   231 VYKLVGSIVCFYIPLGVMLLTYCLTVRLLARQRQNLGGGQQTAAATPGWASGWLGQAPALERRCT 295
            .|.:|.|.:.||.|..||:..||   ||....::::...:  |...|       |:....:|..:
  Fly   294 TYAVVSSCISFYFPCVVMIGIYC---RLYCYAQKHVKSIK--AVTRP-------GEVAEKQRYKS 346

  Fly   296 WRRLLKPGPGNASSV-----LHAHSA 316
            .||     |.|....     ||.||:
  Fly   347 IRR-----PKNQPKKFKVRNLHTHSS 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
5-HT2BNP_001262373.1 7tm_1 90..>262 CDD:278431 77/179 (43%)
7tm_4 90..>238 CDD:304433 67/155 (43%)
Dop1R1NP_001262563.1 7tm_4 134..>266 CDD:304433 61/131 (47%)
7tm_1 145..431 CDD:278431 89/240 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460614
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24247
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.