DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 5-HT2B and mAChR-C

DIOPT Version :9

Sequence 1:NP_001262373.1 Gene:5-HT2B / 41017 FlyBaseID:FBgn0261929 Length:947 Species:Drosophila melanogaster
Sequence 2:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster


Alignment Length:305 Identity:82/305 - (26%)
Similarity:134/305 - (43%) Gaps:74/305 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 AYNDSGGDDW---SSSEHL----VLWEEDETQRTTANATSRHNQLHVARWNATGNATISATFEDV 68
            |:..|....|   ||.|.|    .||:..       |||....::           |:.||    
  Fly     2 AFTSSSSPAWDYRSSPEALGVVPFLWQHQ-------NATETPTEI-----------TLQAT---- 44

  Fly    69 PFDANN-YWALL---ALVLVLGTAAGNILVCLAIAWERRLQNV-TNYFLMSLAITDLMVAVLVMP 128
            .|.|.: .|..:   ..||:||   ||||..:|:...|.|::| :|.|::|||::|..|. |.:|
  Fly    45 SFGAGHLLWLAINAFLFVLILG---GNILTIVAVRTCRHLRSVISNLFILSLAVSDFCVG-LALP 105

  Fly   129 LGILTLVKGYFPLGSE------HCLTWICLDVLFCTASIMHLCTISVDRYLSLRYPMRFGRNKTR 187
            ..::      |.:||:      .||....|.:..|..|::.|.:|:||||:::.|.:.:.|..||
  Fly   106 YHLV------FYMGSDIGAMRGPCLLRFFLLICACCVSMLTLISIAVDRYIAVVYALHYRRYMTR 164

  Fly   188 RRVTLKIVFVWLLSIAMSLPLSLMYSKNHASVLVNGTCQIPD---PVYKLVGSIVCFYIPLGV-M 248
            |.....|:|.|.|...::| |.:.:::...:    ..|:..:   |.| :.|.|...::.:.: |
  Fly   165 RVAYSIIIFNWCLGALVAL-LPVFWNRWPDA----QACEFDEVLAPGY-IAGVITPGFVIIWICM 223

  Fly   249 LLTYCLTVRLLARQ----RQNLGGGQQTAAAT--------PGWAS 281
            .|.|...:|..::|    ||::  ...|..||        |.|.|
  Fly   224 FLVYWRIMREASKQALRLRQSV--VYNTDEATTMRNLLLHPDWKS 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
5-HT2BNP_001262373.1 7tm_1 90..>262 CDD:278431 51/182 (28%)
7tm_4 90..>238 CDD:304433 46/157 (29%)
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 64/224 (29%)
7tm_1 67..321 CDD:278431 60/215 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460639
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.