DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 5-HT2B and Htr1b

DIOPT Version :10

Sequence 1:NP_001262373.1 Gene:5-HT2B / 41017 FlyBaseID:FBgn0261929 Length:947 Species:Drosophila melanogaster
Sequence 2:NP_071561.1 Gene:Htr1b / 25075 RGDID:2846 Length:386 Species:Rattus norvegicus


Alignment Length:244 Identity:85/244 - (34%)
Similarity:121/244 - (49%) Gaps:30/244 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 ALLALVLVLGTAAGNILVCLAIAWERRLQNVTNYFLMSLAITDLMVAVLVMPLGILTLVKGYFPL 141
            |||||: .|.|...|..|...:...|:|....||.:.|||:|||:|::||||:..:..|.|.:.|
  Rat    50 ALLALI-TLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTL 113

  Fly   142 GSEHCLTWICLDVLFCTASIMHLCTISVDRYLSLRYPMRFGRNKTRRRVTLKIVFVWLLSIAMSL 206
            |...|..|:..|:..|||||||||.|::|||.::...:.:...:|.:|..:.||.||:.||::||
  Rat   114 GQVVCDFWLSSDITCCTASIMHLCVIALDRYWAITDAVDYSAKRTPKRAAIMIVLVWVFSISISL 178

  Fly   207 -PLSLMYSKNHASVL---VNGTCQIPDPVYKLVGSIVCFYIPLGVMLLTYCLTVRLLARQRQNLG 267
             |.....:|....||   || |..:...||..||:   ||:|   .||...|..|:....|..: 
  Rat   179 PPFFWRQAKAEEEVLDCFVN-TDHVLYTVYSTVGA---FYLP---TLLLIALYGRIYVEARSRI- 235

  Fly   268 GGQQTAAATPGWASGWLGQAP-ALERRCTWRRLLKPGPGNASSVLHAHS 315
                            |.|.| ...:|.|..:|:...||:.|||...:|
  Rat   236 ----------------LKQTPNKTGKRLTRAQLITDSPGSTSSVTSINS 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
5-HT2BNP_001262373.1 7tmA_5-HT2_insect-like 74..>267 CDD:320433 73/193 (38%)
TM helix 1 75..101 CDD:320433 9/23 (39%)
TM helix 2 108..134 CDD:320433 13/25 (52%)
TM helix 3 146..176 CDD:320433 16/29 (55%)
TM helix 4 188..211 CDD:320433 10/23 (43%)
TM helix 5 229..258 CDD:320433 10/28 (36%)
7tm_GPCRs <799..893 CDD:475119
TM helix 6 818..840 CDD:410628
TM helix 7 854..879 CDD:410628
Htr1bNP_071561.1 7tmA_5-HT1B_1D 42..376 CDD:320455 85/244 (35%)
TM helix 1 47..73 CDD:320455 9/23 (39%)
TM helix 2 80..106 CDD:320455 13/25 (52%)
TM helix 3 118..148 CDD:320455 16/29 (55%)
DRY motif, important for ligand-induced conformation changes and signaling. /evidence=ECO:0000250|UniProtKB:P41595 142..144 1/1 (100%)
TM helix 4 160..183 CDD:320455 10/22 (45%)
TM helix 5 201..230 CDD:320455 11/34 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 255..276 6/14 (43%)
TM helix 6 303..333 CDD:320455
TM helix 7 344..369 CDD:320455
NPxxY motif, important for ligand-induced conformation changes and signaling. /evidence=ECO:0000250|UniProtKB:P41595 361..365
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.