DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 5-HT2B and taar1

DIOPT Version :10

Sequence 1:NP_001262373.1 Gene:5-HT2B / 41017 FlyBaseID:FBgn0261929 Length:947 Species:Drosophila melanogaster
Sequence 2:XP_002935857.1 Gene:taar1 / 100487786 XenbaseID:XB-GENE-961114 Length:339 Species:Xenopus tropicalis


Alignment Length:193 Identity:57/193 - (29%)
Similarity:92/193 - (47%) Gaps:12/193 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 VLGTAAGNILVCLAIAWERRLQNVTNYFLMSLAITDLMVAVLVMPLGILTLVKGYFPLGSEHCLT 148
            :|.|..||:.|.::||..::|...|||.::|::..|.::...|||..::..|:..:..|...|..
 Frog    35 ILATVVGNLAVIISIAHFKQLHTPTNYLILSMSTVDFLLGSCVMPYSMVRSVENCWYFGDLFCKV 99

  Fly   149 WICLDVLFCTASIMHLCTISVDRYLSLRYPMRFGRNKTRRRVTLKIVFVWLLSIAMSLPLSLM-- 211
            ....|::..|:||.||..||||||.::..|:|:........|:|.||..|::....:..:..:  
 Frog   100 HTSTDIMLSTSSIFHLSFISVDRYFAVCDPLRYKTKMNVFSVSLMIVTSWVVPTIFAFTMVFLEL 164

  Fly   212 -------YSKNHASVLVNGTCQI-PDPVYKLVGSIVCFYIPLGVMLLTYCLTVRLLARQRQNL 266
                   |..|..|..  |.|.: ......||.|:|.||||..|||..|.....:..||.:::
 Frog   165 NIKGTESYYYNQVSCF--GGCAVFFSQTSGLVASMVSFYIPGFVMLCVYGKIYVIARRQARSI 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
5-HT2BNP_001262373.1 7tmA_5-HT2_insect-like 74..>267 CDD:320433 57/193 (30%)
TM helix 1 75..101 CDD:320433 7/16 (44%)
TM helix 2 108..134 CDD:320433 8/25 (32%)
TM helix 3 146..176 CDD:320433 13/29 (45%)
TM helix 4 188..211 CDD:320433 5/22 (23%)
TM helix 5 229..258 CDD:320433 12/28 (43%)
7tm_GPCRs <799..893 CDD:475119
TM helix 6 818..840 CDD:410628
TM helix 7 854..879 CDD:410628
taar1XP_002935857.1 7tmA_TAAR1 25..318 CDD:320438 57/193 (30%)
TM helix 1 26..52 CDD:320438 7/16 (44%)
TM helix 2 59..85 CDD:320438 8/25 (32%)
TM helix 3 97..127 CDD:320438 13/29 (45%)
TM helix 4 139..162 CDD:320438 5/22 (23%)
TM helix 5 188..217 CDD:320438 12/28 (43%)
TM helix 6 247..277 CDD:320438
TM helix 7 286..311 CDD:320438
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.