DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pch2 and YTA6

DIOPT Version :9

Sequence 1:NP_001287235.1 Gene:pch2 / 41013 FlyBaseID:FBgn0051453 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_015251.1 Gene:YTA6 / 856031 SGDID:S000005995 Length:754 Species:Saccharomyces cerevisiae


Alignment Length:310 Identity:87/310 - (28%)
Similarity:135/310 - (43%) Gaps:59/310 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 WENLI----YETGLKEKLLKFALSALMFSEHRVDTNVIACNRLILLHGPPGTGKTSLCKALAQKL 190
            ||::.    .:..|||.::...|...:|...|...      |.:||.||||||||.:.||:|   
Yeast   470 WEDIAGLRNAKNSLKEAVVYPFLRPDLFKGLREPV------RGMLLFGPPGTGKTMIAKAVA--- 525

  Fly   191 SIRTQGSYAYTHLVEINSHSLFSKWFSESGKLVAQLFNKIAELVSDPNNLVCVLIDEVESLAYAR 255
               |:.:..:   ..:::.||.||:..||.|||..||....:|  .|:   .:.|||::|:..||
Yeast   526 ---TESNSTF---FSVSASSLLSKYLGESEKLVRALFYMAKKL--SPS---IIFIDEIDSMLTAR 579

  Fly   256 SAMSSNEPRDAMRVVNAVLTQLDSLKTC------------PNVLILATSNLAQSIDLAFVDRADI 308
               |.||...:.|:...:|.|..||.:.            ..||:|..:||..:||.|...|...
Yeast   580 ---SDNENESSRRIKTELLIQWSSLSSATAQSEDRNNTLDSRVLVLGATNLPWAIDDAARRRFSR 641

  Fly   309 RLFIGYPGISAIREIYKGMLAELMSAGVLQREVLESEDAEEGLLTQLAERSVGLSGRTLRKL--- 370
            :|:|..|.       |:..|..|......|:..|:..|.|  |:|::.|   |.||..|..|   
Yeast   642 KLYIPLPD-------YETRLYHLKRLMAKQKNSLQDLDYE--LITEMTE---GFSGSDLTSLAKE 694

  Fly   371 ----PLLAHAQYTSSTLFELDQKISLSDFLDAMLEALEQHLGEQRLLKLE 416
                |:...........|:..:.|.:.||.:|:| .:::.:..:.|.|.|
Yeast   695 AAMEPIRDLGDKLMFADFDKIRGIEIKDFQNALL-TIKKSVSSESLQKYE 743

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pch2NP_001287235.1 AAA 166..315 CDD:214640 53/160 (33%)
AAA 169..314 CDD:278434 52/156 (33%)
YTA6NP_015251.1 SpoVK 201..747 CDD:223540 87/310 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.