DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pch2 and RIX7

DIOPT Version :9

Sequence 1:NP_001287235.1 Gene:pch2 / 41013 FlyBaseID:FBgn0051453 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_013066.1 Gene:RIX7 / 850625 SGDID:S000003957 Length:837 Species:Saccharomyces cerevisiae


Alignment Length:451 Identity:102/451 - (22%)
Similarity:170/451 - (37%) Gaps:120/451 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ALKAYFQTARKLPRNVSFLPDLTAEQTEHVHSVLLERDNGG----------VQPLKVAETKFRFH 87
            |:|..|||.    .|:...| .||..:...:..:.|..||.          :.||.::..:   .
Yeast   428 AIKRIFQTY----ANIKSTP-TTATDSSEDNMEIDETANGDESSLKNTANMIDPLPLSVVQ---Q 484

  Fly    88 FYATRPEEGQLGLFSGEE---GSDGIDSIVAASHALLPAAQFVGL-------WENLIYETGLKEK 142
            |....||.     .|||:   .|...:..:.|...:.|.|:..|.       |.|:    |..::
Yeast   485 FIRNYPEP-----LSGEQLSLLSIKYEDFLKALPTIQPTAKREGFATVPDVTWANV----GALQR 540

  Fly   143 L---LKFALSALMFSEHRVDTNVIACNRLILLHGPPGTGKTSLCKALAQKLSIRTQGSYAYTHLV 204
            :   |..|:...:......:...|:....:||.||||.|||.|.||:|.:         :..:.:
Yeast   541 VRLELNMAIVQPIKRPELYEKVGISAPGGVLLWGPPGCGKTLLAKAVANE---------SRANFI 596

  Fly   205 EINSHSLFSKWFSESGKLVAQLFNKIAELVSDPNNLVCVL-IDEVESLAYARSAMSSNEPRDAMR 268
            .|....|.:|:..||.:.:.|:|.:....|.      ||: .||:::|...|....|   ..:.|
Yeast   597 SIKGPELLNKYVGESERSIRQVFTRARASVP------CVIFFDELDALVPRRDTSLS---ESSSR 652

  Fly   269 VVNAVLTQLDSLKTCPNVLILATSNLAQSIDLAFV--DRADIRLFIGYPGISAIREIYKGM---- 327
            |||.:||:||.|.....:.::..:|....||.|.:  .|.|..|||..|......:|.|.:    
Yeast   653 VVNTLLTELDGLNDRRGIFVIGATNRPDMIDPAMLRPGRLDKSLFIELPNTEEKLDIIKTLTKSH 717

  Fly   328 --------------------------LAELM---SAGVLQREVLESEDAEEGLLTQL----AERS 359
                                      ||.|:   |...|:|:..:||:.:..|...|    .:.|
Yeast   718 GTPLSSDVDFEEIIRNEKCNNFSGADLAALVRESSVLALKRKFFQSEEIQSVLDNDLDKEFEDLS 782

  Fly   360 VGLSGRTLRKLPLLAHAQYTSSTLFELDQKISLSDFLDAMLEALEQHLGEQRLLKLESMEQ 420
            ||:||..:                     .:::|||..| |..::..:.::..||.:.:.:
Yeast   783 VGVSGEEI---------------------IVTMSDFRSA-LRKIKPSVSDKDRLKYDRLNK 821

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pch2NP_001287235.1 AAA 166..315 CDD:214640 46/151 (30%)
AAA 169..314 CDD:278434 46/147 (31%)
RIX7NP_013066.1 CDC48 <192..824 CDD:273521 102/451 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.