DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pch2 and ATAD1

DIOPT Version :9

Sequence 1:NP_001287235.1 Gene:pch2 / 41013 FlyBaseID:FBgn0051453 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001308896.1 Gene:ATAD1 / 84896 HGNCID:25903 Length:361 Species:Homo sapiens


Alignment Length:296 Identity:71/296 - (23%)
Similarity:131/296 - (44%) Gaps:62/296 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 GIDSIVAASHALLPAAQFVG------LWENLI----YETGLKEKLLKFALSALMFSEHRVDTNVI 163
            |:.::..:.:.:..||..|.      .|.::.    ..|.||:.::.......:|...|    ::
Human    63 GVKNVKLSEYEMSIAAHLVDPLNMHVTWSDIAGLDDVITDLKDTVILPIKKKHLFENSR----LL 123

  Fly   164 ACNRLILLHGPPGTGKTSLCKALAQKLSIRTQGSYAYTHLVEINSHSLFSKWFSESGKLVAQLFN 228
            ...:.:||:||||.|||.:.||.|::...|         .:.:...:|..||:.||.||.|.:|:
Human   124 QPPKGVLLYGPPGCGKTLIAKATAKEAGCR---------FINLQPSTLTDKWYGESQKLAAAVFS 179

  Fly   229 KIAELVSDPNNLVCVLIDEVESLAYARSAMSSNEPRDAMRVVN--AVLTQLDSLKTCPNVLILAT 291
            ...:|  .|:   .:.|||::|  :.|:..||:....||....  ::...||:..:| .|:::..
Human   180 LAIKL--QPS---IIFIDEIDS--FLRNRSSSDHEATAMMKAQFMSLWDGLDTDHSC-QVIVMGA 236

  Fly   292 SNLAQSIDLAFVDRADIRLFIGYPGISAIREIYKGMLAELMSAGVLQRE-----VLESEDAEEGL 351
            :|..|.:|.|.:.|...|..|..|.:.                   |||     :|::|:.:..:
Human   237 TNRPQDLDSAIMRRMPTRFHINQPALK-------------------QREAILKLILKNENVDRHV 282

  Fly   352 -LTQLAERSVGLSGRTLRKL----PLLAHAQYTSST 382
             |.::|:.:.|.||..|:::    .||...:|.:||
Human   283 DLLEVAQETDGFSGSDLKEMCRDAALLCVREYVNST 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pch2NP_001287235.1 AAA 166..315 CDD:214640 44/150 (29%)
AAA 169..314 CDD:278434 44/146 (30%)
ATAD1NP_001308896.1 RecA-like_ATAD1 92..257 CDD:410928 48/185 (26%)
AAA_lid_3 282..321 CDD:407720 11/37 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.