DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pch2 and spata5l1

DIOPT Version :9

Sequence 1:NP_001287235.1 Gene:pch2 / 41013 FlyBaseID:FBgn0051453 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001070056.2 Gene:spata5l1 / 767648 ZFINID:ZDB-GENE-060929-204 Length:748 Species:Danio rerio


Alignment Length:361 Identity:93/361 - (25%)
Similarity:150/361 - (41%) Gaps:75/361 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LPDLTAEQTEHVHSVLLERDNGGVQPLKVAETKFRFHFYATRPEEGQLGLFSGEEGSDGIDSIVA 115
            |.||:..:.| :..||:|:.|.|.|                     :.||.:.....| |.:|..
Zfish   132 LVDLSGVKAE-IRCVLVEKVNSGSQ---------------------RAGLITARTCVD-ISTIQT 173

  Fly   116 ASH-----ALLPAAQFVGLWENLIYETGLKEKL---LKFALSALMFSEHRVDTNVIACNRLILLH 172
            ..|     ..:.||...|: |::.  ..|||.:   |::..|.....        ::|.|.:||.
Zfish   174 VKHLDRQQQQVSAAPLGGM-EDVF--ASLKEMITFPLRYPGSLRQLG--------LSCPRGLLLI 227

  Fly   173 GPPGTGKTSLCKALAQKLSIRTQGSYAYTHLVEINSHSLFSKWFSESGKLVAQLFNKIAELVSD- 236
            ||||.|||.|.:.:|:.:.         ..||.:|...:......||.:.:.::|.:..:...| 
Zfish   228 GPPGVGKTLLVRCVAKDIG---------ATLVTVNGPEVTGSRPGESEENLRRVFEQARDAADDG 283

  Fly   237 PNNLVCV-LIDEVESLAYARSAMSSNEPRDAMRVVNAVLTQLDSLKTCPNVLILATSNLAQSIDL 300
            |    || ||||::||...|:. ||:.|.:  |:|..:||.:|::.:....:|:..:|...|:|.
Zfish   284 P----CVLLIDEIDSLCPRRTG-SSSAPEN--RLVAQLLTLMDAIGSHEGFVIIGATNQPDSLDP 341

  Fly   301 AF--VDRADIRLFIGYPGISAIREIYKGMLAELMSAGVLQREVLESEDAEEGLLTQLAERSVGLS 363
            |.  ..|.|..:.||.|.:...|.|.|          .:.||:..|.|.:   |..|||.:.|..
Zfish   342 ALRRPGRFDREVIIGVPSLLQRRSILK----------CVCREMPLSPDVD---LNTLAEMTCGYV 393

  Fly   364 GRTLRKLPLLAHAQYTSSTLFELDQKISLSDFLDAM 399
            |..|..|...|..|....:.....:.:|:..|:.|:
Zfish   394 GADLSALSREAALQAMRHSQMGASEPVSMQHFMQAL 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pch2NP_001287235.1 AAA 166..315 CDD:214640 46/152 (30%)
AAA 169..314 CDD:278434 44/148 (30%)
spata5l1NP_001070056.2 CDC48 13..740 CDD:273521 93/361 (26%)
AAA 224..357 CDD:278434 44/148 (30%)
AAA 489..655 CDD:278434
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.