Sequence 1: | NP_001287235.1 | Gene: | pch2 / 41013 | FlyBaseID: | FBgn0051453 | Length: | 421 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011242039.1 | Gene: | Fignl1 / 60530 | MGIID: | 1890648 | Length: | 692 | Species: | Mus musculus |
Alignment Length: | 204 | Identity: | 66/204 - (32%) |
---|---|---|---|
Similarity: | 94/204 - (46%) | Gaps: | 31/204 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 169 ILLHGPPGTGKTSLCKALAQKLSIRTQGSYAYTHLVEINSHSLFSKWFSESGKLVAQLFNKIAEL 233
Fly 234 VSDPNNLVCVLIDEVESLAYARSAMSSNEPRDAMRVVNAVLTQLDSLKTC--PNVLILATSNLAQ 296
Fly 297 SIDLAFVDRADIRLFIGYPGISAIREIYKGMLAELMSAGVLQREVLESEDAEEGLLTQLAERSVG 361
Fly 362 LSGRTLRKL 370 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
pch2 | NP_001287235.1 | AAA | 166..315 | CDD:214640 | 49/147 (33%) |
AAA | 169..314 | CDD:278434 | 49/146 (34%) | ||
Fignl1 | XP_011242039.1 | RecA-like_Figl-1 | 398..583 | CDD:410933 | 48/144 (33%) |
AAA_lid_3 | 608..>639 | CDD:407720 | 9/25 (36%) | ||
Vps4_C | <649..689 | CDD:401324 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0464 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |