DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pch2 and Fignl1

DIOPT Version :9

Sequence 1:NP_001287235.1 Gene:pch2 / 41013 FlyBaseID:FBgn0051453 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_011242039.1 Gene:Fignl1 / 60530 MGIID:1890648 Length:692 Species:Mus musculus


Alignment Length:204 Identity:66/204 - (32%)
Similarity:94/204 - (46%) Gaps:31/204 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 ILLHGPPGTGKTSLCKALAQKLSIRTQGSYAYTHLVEINSHSLFSKWFSESGKLVAQLFNKIAEL 233
            |||.||||||||.:.|.:|.:     .|:..::    |::.||.|||..|..|:|..||     .
Mouse   455 ILLFGPPGTGKTLIGKCIASQ-----SGATFFS----ISASSLTSKWVGEGEKMVRALF-----A 505

  Fly   234 VSDPNNLVCVLIDEVESLAYARSAMSSNEPRDAMRVVNAVLTQLDSLKTC--PNVLILATSNLAQ 296
            |:.......:.|||::||.   |.....|...:.|:....|.|||...|.  ..:|::..:|..|
Mouse   506 VARCQQPAVIFIDEIDSLL---SQRGDGEHESSRRIKTEFLVQLDGATTSSEDRILVVGATNRPQ 567

  Fly   297 SIDLAFVDRADIRLFIGYPGISAIREIYKGMLAELMSAGVLQREVLESEDAEEGLLTQLAERSVG 361
            .||.|...|...||:|..|..||.::|    :..|||     :|.....|.|..|:.|   :|.|
Mouse   568 EIDEAARRRLVKRLYIPLPEASARKQI----VGNLMS-----KEQCCLSDEETDLVVQ---QSDG 620

  Fly   362 LSGRTLRKL 370
            .||..:.:|
Mouse   621 FSGADMTQL 629

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pch2NP_001287235.1 AAA 166..315 CDD:214640 49/147 (33%)
AAA 169..314 CDD:278434 49/146 (34%)
Fignl1XP_011242039.1 RecA-like_Figl-1 398..583 CDD:410933 48/144 (33%)
AAA_lid_3 608..>639 CDD:407720 9/25 (36%)
Vps4_C <649..689 CDD:401324
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.