DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pch2 and FIGN

DIOPT Version :9

Sequence 1:NP_001287235.1 Gene:pch2 / 41013 FlyBaseID:FBgn0051453 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_011509691.1 Gene:FIGN / 55137 HGNCID:13285 Length:785 Species:Homo sapiens


Alignment Length:301 Identity:74/301 - (24%)
Similarity:125/301 - (41%) Gaps:58/301 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 WENL----IYETGLKEKLLKFALSALMFSEHRVDTNVIACNRLILLHGPPGTGKTSLCKALAQKL 190
            |.::    :.:..:||::|...|.:..||      .:.|..|.|||.||.|||||.|.:.:|.:|
Human   511 WNDIAGLDLVKAVIKEEVLWPVLRSDAFS------GLTALPRSILLFGPRGTGKTLLGRCIASQL 569

  Fly   191 SIRTQGSYAYTHLVEINSHSLFSKWFSESGKLVAQLFNKIAELVSDPNNLVCVLIDEVESLAYAR 255
            .         ....:|....|.:||..|:.|::...|     ||:.......:.:.:::.|.   
Human   570 G---------ATFFKIAGSGLVAKWLGEAEKIIHASF-----LVARCRQPSVIFVSDIDMLL--- 617

  Fly   256 SAMSSNEPRDAMRVVNAVLTQLDSLKTCPN---VLILATS---NLAQSIDLAFVDRADIRLFIGY 314
            |:..:.|.....|:....|.|||::.|...   |:|.|||   .:.:|:...|:.    ||.|..
Human   618 SSQVNEEHSPVSRMRTEFLMQLDTVLTSAEDQIVVICATSKPEEIDESLRRYFMK----RLLIPL 678

  Fly   315 PGISAIREIYKGMLAELMSAGVLQREVLESEDAEEGLLTQLAERSVGLSGRTLRKL-------PL 372
            |..:|..:|    :.:|:|    |.... ..|.|..||.|   |:.|.||..:..|       ||
Human   679 PDSTARHQI----IVQLLS----QHNYC-LNDKEFALLVQ---RTEGFSGLDVAHLCQEAVVGPL 731

  Fly   373 LAHAQYTSSTLFELD-QKISLSDFLDAMLEALEQHLGEQRL 412
            .|......|.:.... :.::..||.:|..: ::..:.::.|
Human   732 HAMPATDLSAIMPSQLRPVTYQDFENAFCK-IQPSISQKEL 771

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pch2NP_001287235.1 AAA 166..315 CDD:214640 42/154 (27%)
AAA 169..314 CDD:278434 41/150 (27%)
FIGNXP_011509691.1 AAA 545..680 CDD:214640 42/155 (27%)
AAA 548..678 CDD:278434 41/150 (27%)
Vps4_C <749..782 CDD:286426 4/24 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.