DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pch2 and PEX6

DIOPT Version :9

Sequence 1:NP_001287235.1 Gene:pch2 / 41013 FlyBaseID:FBgn0051453 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_000278.3 Gene:PEX6 / 5190 HGNCID:8859 Length:980 Species:Homo sapiens


Alignment Length:487 Identity:105/487 - (21%)
Similarity:187/487 - (38%) Gaps:136/487 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LSNSDTVH-------VEVCLRGNDLRSNAIRNNVETALKAYFQTARKLP-----RNVSFLPDLTA 56
            |.|.|.::       |....|..||.:     :|:||    |....::|     :.:|.|..|||
Human   555 LLNEDPLNSCPPLMVVATTSRAQDLPA-----DVQTA----FPHELEVPALSEGQRLSILRALTA 610

  Fly    57 EQT--EHVHSVLLERDNGG----------VQPLKVAETKFRFHFYA---TRPEEGQL---GL-FS 102
            ...  :.|:...|.|...|          ....:.|.|:.:....|   |..:||:|   |. ..
Human   611 HLPLGQEVNLAQLARRCAGFVVGDLYALLTHSSRAACTRIKNSGLAGGLTEEDEGELCAAGFPLL 675

  Fly   103 GEEGSDGIDSIVAASHALLPAAQFVGL-WENLIYETGLKEKLLKFALSALMFSEHRVDTNVIACN 166
            .|:....::.:..|....:.|.:...: |    ::.|..:::.|..|..:.......:...:...
Human   676 AEDFGQALEQLQTAHSQAVGAPKIPSVSW----HDVGGLQEVKKEILETIQLPLEHPELLSLGLR 736

  Fly   167 RL-ILLHGPPGTGKTSLCKALAQKLSIRTQGSYAYTHLVEINSHSLFSKWFSESGKLVAQLFNKI 230
            |. :|||||||||||.|.||:|.:.|:.         .:.:....|.:.:..:|.:.|.::|.:.
Human   737 RSGLLLHGPPGTGKTLLAKAVATECSLT---------FLSVKGPELINMYVGQSEENVREVFARA 792

  Fly   231 AELVSDPNNLVCVL-IDEVESLAYARSAMSSNEPRDAM-RVVNAVLTQLDSLKTCPNVLILATSN 293
            .....      |:: .||::|||.:|.  .|.:....| |||:.:|.:||.|.:..:|.::..:|
Human   793 RAAAP------CIIFFDELDSLAPSRG--RSGDSGGVMDRVVSQLLAELDGLHSTQDVFVIGATN 849

  Fly   294 LAQSIDLAFV--DRADIRLFIG---------------------YPGISAIR------------EI 323
            ....:|.|.:  .|.|..:|:|                     .|.:|.:.            ::
Human   850 RPDLLDPALLRPGRFDKLVFVGANEDRASQLRVLSAITRKFKLEPSVSLVNVLDCCPPQLTGADL 914

  Fly   324 YKGMLAELMSAGVLQREVLESEDAEEGLLTQLAERSVGLSGRTLRKLPLLAHAQYTSSTLFELDQ 388
            | .:.::.|:| .|:|.|   .|.||||                         :..||.|.    
Human   915 Y-SLCSDAMTA-ALKRRV---HDLEEGL-------------------------EPGSSALM---- 945

  Fly   389 KISLSDFLDAMLEALEQHLGEQRLLKLESMEQ 420
             :::.|.|.|... |:..:.||.||:.:.:::
Human   946 -LTMEDLLQAAAR-LQPSVSEQELLRYKRIQR 975

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pch2NP_001287235.1 AAA 166..315 CDD:214640 45/174 (26%)
AAA 169..314 CDD:278434 44/169 (26%)
PEX6NP_000278.3 SpoVK 463..967 CDD:223540 103/477 (22%)
AAA 466..594 CDD:278434 11/47 (23%)
AAA 743..871 CDD:278434 41/144 (28%)
Vps4_C 918..977 CDD:286426 21/93 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.