DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pch2 and Nsf2

DIOPT Version :9

Sequence 1:NP_001287235.1 Gene:pch2 / 41013 FlyBaseID:FBgn0051453 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001287318.1 Gene:Nsf2 / 41694 FlyBaseID:FBgn0266464 Length:752 Species:Drosophila melanogaster


Alignment Length:301 Identity:71/301 - (23%)
Similarity:133/301 - (44%) Gaps:50/301 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 LLKFALSALMFSEHRVDTNVIACNRLILLHGPPGTGKTSLCKALAQKLSIRTQGSYAYTHLVEIN 207
            :.:.|.::.:|....|:...|...:.|||:||||||||.:.:.:...|:.|....        :|
  Fly   235 IFRRAFASRVFPPELVEQLGIKHVKGILLYGPPGTGKTLMARQIGTMLNAREPKI--------VN 291

  Fly   208 SHSLFSKWFSESGKLVAQLFNKIAELVS--DPNN-LVCVLIDEVESLAYARSAMSSNE-PRDAMR 268
            ...:..|:..||...:.:||.:..|...  .||: |..::.||::::..||.:::.|. ..|.  
  Fly   292 GPQILDKYVGESEANIRRLFAEAEEEEKRLGPNSGLHIIIFDEIDAICKARGSVAGNSGVHDT-- 354

  Fly   269 VVNAVLTQLDSLKTCPNVLILATSNLAQSIDLAFV--DRADIRLFIGYP---GISAIREIYKGML 328
            |||.:|.::|.::...|:|::..:|....||.|.:  .|.::::.|..|   |...|..|:...:
  Fly   355 VVNQLLAKIDGVEQLNNILVIGMTNRRDMIDEALLRPGRLEVQMEISLPNEQGRVQILNIHTKRM 419

  Fly   329 AELMSAGVLQREVLESEDAEEGLLTQLAERSVGLSGRTLRKLPLLAHAQYTS-STLFELDQKISL 392
            .:.       .::....|..|     :|.::...||..|.  .|:..||.|: :.|.:.|.|:.:
  Fly   420 RDF-------NKIASDVDNNE-----IAAKTKNFSGAELE--GLVRAAQSTAMNRLIKADSKVHV 470

  Fly   393 ------------SDFLDAMLEALEQHLGEQRLLKLESMEQL 421
                        :|||.|:...::...|..:    |.:|.|
  Fly   471 DPEAMEKLRVTRADFLHALDNDIKPAFGAAQ----EMLENL 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pch2NP_001287235.1 AAA 166..315 CDD:214640 42/154 (27%)
AAA 169..314 CDD:278434 42/150 (28%)
Nsf2NP_001287318.1 CDC48_N 9..89 CDD:215012
CDC48_2 117..>170 CDD:215011
AAA 259..404 CDD:214640 42/154 (27%)
AAA 261..402 CDD:278434 42/150 (28%)
AAA 543..674 CDD:214640
P-loop_NTPase 544..>613 CDD:304359
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.