DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pch2 and CG16789

DIOPT Version :9

Sequence 1:NP_001287235.1 Gene:pch2 / 41013 FlyBaseID:FBgn0051453 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_649910.3 Gene:CG16789 / 41154 FlyBaseID:FBgn0037712 Length:831 Species:Drosophila melanogaster


Alignment Length:391 Identity:78/391 - (19%)
Similarity:137/391 - (35%) Gaps:119/391 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RGNDLRSNAIRNNVETALKAYFQTARKLPRNVSFLPDLTAEQTEHVHSVLLERDNGGVQPLKVAE 81
            |..||..|  .|..|   :..||.|..:     .|||:.|| .:..:....::|..||    :::
  Fly   381 RSGDLNVN--ENQDE---EVSFQPAPSV-----CLPDIRAE-IDLFNDTWRDKDETGV----LSQ 430

  Fly    82 TKFRFHFYATRPEEGQLGLFSGEEGSDGIDSIVAASHALLPAAQFVG------------------ 128
            ..:....|:.:.:|.:|      |....:|.::.....||..|  ||                  
  Fly   431 AAYEDMIYSDKYQEVEL------EFRRAVDDVMRQEIELLQTA--VGKKVKKSSKKTRRSGKKSK 487

  Fly   129 ---------------LWENLIY--------ETGLKEKLLKFALSALMFSEHRVDTN--------- 161
                           |:|.|:.        |..||:.|...||:|      |:.||         
  Fly   488 KKKEKDLTPDRTTESLYEELVTNGIIRKYPELRLKQFLGDKALTA------RIGTNPSPGDIRQI 546

  Fly   162 -------------VIACN---RLILLHGPPGTGKTSLCKALAQKLSIRTQGSYAYTHLVEINSHS 210
                         :..|.   |.|||.||.|:||.:|..|:..::.         ..|.::...:
  Fly   547 LTEYCILPLGSDAIHNCTPLIRSILLAGPKGSGKKALLHAICTEVG---------AVLFDLTPAN 602

  Fly   211 LFSKWFSESGK-LVAQLFNKIAELVSDPNNLVCVLIDEVESLAYARSAMS---SNEPRDAMRVVN 271
            :..|:..:||. ::..|..|::.|:..    ..:.:.:.|     |..|.   ..:..|..|:..
  Fly   603 IVGKYPGKSGLIMLIHLVLKVSRLLQP----AVIFMGDAE-----RPFMKKIPKTDRTDPKRLKK 658

  Fly   272 AVLTQLDSLKTCPNVLILATSNLAQSIDLAFVDRADIR-LFIGYPGISAIREIYKGMLAELMSAG 335
            .:...:.::.....|:.:.||||....|...:.....| ::|..|...|:...:|.:|.: .|.|
  Fly   659 DLPKLIKNIAPEDRVVFIGTSNLPWEADQKLLQSVYNRFIYIPRPDYGAMSHAWKTLLHD-YSGG 722

  Fly   336 V 336
            :
  Fly   723 I 723

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pch2NP_001287235.1 AAA 166..315 CDD:214640 31/156 (20%)
AAA 169..314 CDD:278434 30/149 (20%)
CG16789NP_649910.3 AAA 568..704 CDD:214640 31/153 (20%)
AAA 570..702 CDD:278434 30/149 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.