DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pch2 and IQCA1L

DIOPT Version :9

Sequence 1:NP_001287235.1 Gene:pch2 / 41013 FlyBaseID:FBgn0051453 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001291348.1 Gene:IQCA1L / 392843 HGNCID:22831 Length:818 Species:Homo sapiens


Alignment Length:251 Identity:53/251 - (21%)
Similarity:101/251 - (40%) Gaps:59/251 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 RLILLHGPPGTGKTSLCKALAQKLSIRTQGSYAYTHLVEINSHSLFSKWFSESG-KLVAQLFNKI 230
            |.|||.||.|.||..|.||:..:..         .:|.:::..:|..|:...:| :::..:..|:
Human   561 RSILLVGPSGMGKKMLVKAVCTETG---------ANLFDLSPENLLGKYPGRNGAQMMVHIVFKV 616

  Fly   231 AELVSDPNNLVCVLIDEVESLAYARSAMSSNEPRDAMRVVNAVLTQLDSLKTCPNVLILATSNLA 295
            |.|: .|:   .:.|...|...|.::.....| .|..|:...:...|..|.....|:::.|::..
Human   617 ARLL-QPS---VIWIGNAEKNFYKKTPKEDKE-MDPKRIKKDLTKALRLLTPGDRVMLIGTTSRP 676

  Fly   296 QSIDLAFVDRADIR-LFIGYPGISAIREIYKGMLAELMSAGVLQREVLESEDAEEGLLTQLAERS 359
            |..::..:.|...| ||:..|..::...::|.|:.   :.|:...:.|:        ::.||:.|
Human   677 QLAEMRGLCRVYERILFMPRPDYASRYVLWKRMIE---ARGIQPTQHLD--------ISALAKVS 730

  Fly   360 VGLSGRTLRKLPLLAHAQYTSSTLFELDQKISLSDFLDAMLEALEQHLGEQRLLKL 415
            .|                ||...:                |:|::..|.|:|.|:|
Human   731 DG----------------YTPGHI----------------LQAIQSVLSERRFLQL 754

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pch2NP_001287235.1 AAA 166..315 CDD:214640 35/149 (23%)
AAA 169..314 CDD:278434 34/146 (23%)
IQCA1LNP_001291348.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 344..377
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 458..482
SpoVK <561..734 CDD:223540 44/213 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 795..818
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.