DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pch2 and CG12010

DIOPT Version :9

Sequence 1:NP_001287235.1 Gene:pch2 / 41013 FlyBaseID:FBgn0051453 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_728878.1 Gene:CG12010 / 38421 FlyBaseID:FBgn0035443 Length:717 Species:Drosophila melanogaster


Alignment Length:240 Identity:56/240 - (23%)
Similarity:105/240 - (43%) Gaps:49/240 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 ILLHGPPGTGKTSLCKALAQKLSIRTQGSYAYTHLVEINSHSLFSKWFSESGKLVAQLFNKIAEL 233
            :||:||||..||::.|.||::..:    ::..|...|:     :|.:...:.:.::::|:...: 
  Fly   487 VLLYGPPGCAKTTVAKCLAKEADM----TFIATSAAEV-----YSPYVGCAERFISRIFDTARK- 541

  Fly   234 VSDPNNLVC-VLIDEVESLAYARSAMSSNEPRDA-MRVVNAVLTQLDSL---KTCPNVLILATSN 293
                 |..| :.:||::||...|:..|....... :|:::.:||:::.:   .:..::|::|.:|
  Fly   542 -----NAPCLIFLDEIDSLVGRRTVSSGGGGGQVQLRILSTLLTEMNGIVGGGSQQHILVVAATN 601

  Fly   294 LAQSIDLAFV--DRADIRLFIGYPGISAIREIYKGMLAELMSAGVLQREVLESEDA---EEGLLT 353
            ....||.|.:  .|.|..:.:..|.       .|..||.|.         |.|:..   |...|.
  Fly   602 RPDMIDDALLRPGRFDKLIHVPAPD-------EKSRLALLK---------LHSQRMPFHENVFLQ 650

  Fly   354 QLAERSVGLSGRTLRKLPLLAHAQYTSSTLFELDQK---ISLSDF 395
            ::|.|:...||..|..|     ....:...|:.|.|   |.|.||
  Fly   651 EIAARTDRYSGADLCNL-----CNEAAIEAFQRDFKATEIELQDF 690

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pch2NP_001287235.1 AAA 166..315 CDD:214640 34/152 (22%)
AAA 169..314 CDD:278434 34/151 (23%)
CG12010NP_728878.1 SpoVK 201..707 CDD:223540 56/240 (23%)
AAA 224..357 CDD:278434
AAA 487..623 CDD:278434 34/150 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.