DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pch2 and nsfa

DIOPT Version :9

Sequence 1:NP_001287235.1 Gene:pch2 / 41013 FlyBaseID:FBgn0051453 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_021325418.1 Gene:nsfa / 368483 ZFINID:ZDB-GENE-030616-37 Length:747 Species:Danio rerio


Alignment Length:289 Identity:66/289 - (22%)
Similarity:131/289 - (45%) Gaps:48/289 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 LLKFALSALMFSEHRVDTNVIACNRL--ILLHGPPGTGKTSLCKALAQKLSIRTQGSYAYTHLVE 205
            :.:.|.::.:|....|:.  :.|..:  |||.||||.|||.:.:.:.:.|:.|....        
Zfish   230 IFRRAFASRVFPPDIVEQ--MGCKHVKGILLFGPPGCGKTLMARQIGKMLNAREPKI-------- 284

  Fly   206 INSHSLFSKWFSESGKLVAQLFNKIAE---LVSDPNNLVCVLIDEVESLAYAR-SAMSSNEPRDA 266
            :|...:.:|:..||...:.:||....|   .:...:.|..::.||::::...| :..||....|.
Zfish   285 VNGPEILNKYVGESEANIRKLFADAEEEQKRLGANSGLHIIIFDELDAICKQRGTGASSTGVHDT 349

  Fly   267 MRVVNAVLTQLDSLKTCPNVLILATSNLAQSIDLAFV--DRADIRLFIGYP---GISAIREIYKG 326
              |||.:|:::|.::...|:|::..:|....||.|.:  .|.::::.||.|   |...|..|:..
Zfish   350 --VVNQLLSKIDGVEQLNNILVIGMTNRPDLIDEALMRPGRFEVKMEIGLPDEKGRVQILNIHTA 412

  Fly   327 MLAELMSAGVLQREVLESE-DAEEGLLTQLAERSVGLSGRTLRKLPLLA-------HAQYTSSTL 383
            .:.|.        ::|.|: |.:|     ||..:...||..|..|...|       |.:.||:..
Zfish   413 KMREF--------KLLASDVDVKE-----LAAETKNYSGAELEGLVRAAQSTAMNRHIKATSTVE 464

  Fly   384 FELDQ----KISLSDFLDAMLEALEQHLG 408
            .::::    :::.:||:.::...::...|
Zfish   465 VDMERAEKLQVTRTDFMASLNNDIKPAFG 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pch2NP_001287235.1 AAA 166..315 CDD:214640 40/156 (26%)
AAA 169..314 CDD:278434 39/150 (26%)
nsfaXP_021325418.1 CDC48_N 6..83 CDD:215012
CDC48_2 111..183 CDD:215011
TIP49 160..>606 CDD:332389 66/289 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.