DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pch2 and Spast

DIOPT Version :9

Sequence 1:NP_001287235.1 Gene:pch2 / 41013 FlyBaseID:FBgn0051453 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_008762708.1 Gene:Spast / 362700 RGDID:1308494 Length:614 Species:Rattus norvegicus


Alignment Length:286 Identity:79/286 - (27%)
Similarity:128/286 - (44%) Gaps:45/286 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 EKLLKFALSALMF---SEHRVDTNVIACNRLILLHGPPGTGKTSLCKALAQKLSIRTQGSYAYTH 202
            ::|.|.||..::.   ....:.|.:.|..|.:||.||||.|||.|.||:|.:         :...
  Rat   345 QELAKQALQEIVILPSLRPELFTGLRAPARGLLLFGPPGNGKTMLAKAVAAE---------SNAT 400

  Fly   203 LVEINSHSLFSKWFSESGKLVAQLFNKIAELVSDPNNLVCVLIDEVESLAYARSAMSSNEPRDAM 267
            ...|::.||.||:..|..|||..||....||  .|:   .:.||||:||...|   ...|...:.
  Rat   401 FFNISAASLTSKYVGEGEKLVRALFAVAREL--QPS---IIFIDEVDSLLCER---REGEHDASR 457

  Fly   268 RVVNAVLTQLDSLKTC--PNVLILATSNLAQSIDLAFVDRADIRLFIGYPGISAIREIYKGMLAE 330
            |:....|.:.|.:::.  ..||::..:|..|.:|.|.:.|...|:::..|.......:.|.:|.:
  Rat   458 RLKTEFLIEFDGVQSAGDDRVLVMGATNRPQELDEAVLRRFIKRVYVSLPNEETRLLLLKNLLCK 522

  Fly   331 LMSAGVLQREVLESEDAEEGLLTQLAERSVGLSGRTLRKL-------PL--LAHAQYTSSTLFEL 386
             ..:.:.|:|           |.|||..:.|.||..|..|       |:  |...|..:.:..|:
  Rat   523 -QGSPLTQKE-----------LAQLARMTDGYSGSDLTALAKDAALGPIRELKPEQVKNMSASEM 575

  Fly   387 DQKISLSDFLDAMLEALEQHLGEQRL 412
             :.|.||||.:: |:.:::.:..|.|
  Rat   576 -RNIRLSDFTES-LKKIKRSVSPQTL 599

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pch2NP_001287235.1 AAA 166..315 CDD:214640 47/150 (31%)
AAA 169..314 CDD:278434 46/146 (32%)
SpastXP_008762708.1 MIT_spastin 114..193 CDD:239142
P-loop_NTPase 339..>395 CDD:304359 19/49 (39%)
AAA 372..508 CDD:214640 47/152 (31%)
AAA 376..506 CDD:278434 46/146 (32%)
Vps4_C <578..610 CDD:286426 8/23 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.