DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pch2 and TER94

DIOPT Version :9

Sequence 1:NP_001287235.1 Gene:pch2 / 41013 FlyBaseID:FBgn0051453 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001097249.1 Gene:TER94 / 36040 FlyBaseID:FBgn0286784 Length:826 Species:Drosophila melanogaster


Alignment Length:245 Identity:68/245 - (27%)
Similarity:107/245 - (43%) Gaps:46/245 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 LWENLIYETGLKEKLLKFALSALMFSEHRVDTNVIACNRLILLHGPPGTGKTSLCKALAQKLSIR 193
            |.|.:.|.....:|.|||.:..               :|.:|.:||||.|||.|.||:|.:    
  Fly   511 LQELVQYPVEHPDKFLKFGMQP---------------SRGVLFYGPPGCGKTLLAKAIANE---- 556

  Fly   194 TQGSYAYTHLVEINSHSLFSKWFSESGKLVAQLFNKIAELVSDPNNLVCVL-IDEVESLAYARSA 257
                 ...:.:.:....|.:.||.||...|..:|:|......      ||| .||::|:|.||..
  Fly   557 -----CQANFISVKGPELLTMWFGESEANVRDIFDKARSAAP------CVLFFDELDSIAKARGG 610

  Fly   258 MSSNEPRDAMRVVNAVLTQLDSLKTCPNVLILATSNLAQSIDLAFV--DRADIRLFIGYPGISAI 320
            ...:....|.||:|.:||::|.:....||.|:..:|....||.|.:  .|.|..::|..|...: 
  Fly   611 NVGDAGGAADRVINQILTEMDGMGAKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDDKS- 674

  Fly   321 REIYKGMLAELMSAGVLQREVLESEDAEEGLLTQLAERSVGLSGRTLRKL 370
            ||            .:|:..:.:|..|:|..||.:|:.:.|.||..|.::
  Fly   675 RE------------AILKANLRKSPLAKEVDLTYIAKVTQGFSGADLTEI 712

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pch2NP_001287235.1 AAA 166..315 CDD:214640 47/151 (31%)
AAA 169..314 CDD:278434 46/147 (31%)
TER94NP_001097249.1 CDC48 47..787 CDD:273521 68/245 (28%)
CDC48_N 47..129 CDD:280513
CDC48_2 153..213 CDD:215011
AAA 263..392 CDD:278434
AAA 536..669 CDD:278434 46/147 (31%)
Vps4_C <741..783 CDD:286426
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.