DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pch2 and CG4701

DIOPT Version :9

Sequence 1:NP_001287235.1 Gene:pch2 / 41013 FlyBaseID:FBgn0051453 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_609721.1 Gene:CG4701 / 34858 FlyBaseID:FBgn0028868 Length:384 Species:Drosophila melanogaster


Alignment Length:324 Identity:87/324 - (26%)
Similarity:143/324 - (44%) Gaps:58/324 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 IVAASHALLPAAQFVGLWENLIYETGLKEKLLKFALSALMFSEHRVDTNVIACNRL------ILL 171
            ::.|||.:.|....:. |.::   .||...:.:...:.::...||   .:.:.::|      :||
  Fly    78 MMIASHLVTPEDIDIS-WSDI---AGLDGTIQELRETVVLPVRHR---KLFSRSKLWRAPKGVLL 135

  Fly   172 HGPPGTGKTSLCKALAQKLSIRTQGSYAYTHLVEINSHSLFSKWFSESGKLVAQLFNKIAELVSD 236
            |||||.|||.:.||:|:...:|         .:.::...|..||:.||.||...:|....:|  .
  Fly   136 HGPPGCGKTLIAKAIAKDAGMR---------FINLDVGVLTDKWYGESQKLATAVFTLAKKL--Q 189

  Fly   237 PNNLVCVL-IDEVESLAYARSAMSSNEPRDAMRVVNAVLTQLDSLKTCPN--VLILATSNLAQSI 298
            |    |:: |||:||....|   .||:......:....:.|.|.|.:..|  ||:|..:|..|.:
  Fly   190 P----CIIFIDEIESFLRMR---GSNDHEATAMIKTQFMLQWDGLMSNTNICVLVLGATNRPQDL 247

  Fly   299 DLAFVDRADIRLFIGYPGISAIREIYKGMLAELMSAGVLQREVLESEDAEEGL-LTQLAERSVGL 362
            |.|.:.|...:..||.|.....|||             ||. :|::|.....: |.:||..::|.
  Fly   248 DKAILRRMPAQFHIGVPRDCQRREI-------------LQL-ILQTEQLSPSVNLKELARLTIGF 298

  Fly   363 SGRTLRKLPLLAHAQYTSSTLFELDQKISL-----SDFLDAMLEALEQHLGEQRLLKLESMEQL 421
            ||..||:  |..||.......| :.:|::.     .|.::...|..:|.|.|...|::: ||.|
  Fly   299 SGSDLRE--LCRHASMYRMRQF-MREKLNTGEEIGKDKIEWDFEVKDQALQEWEHLEIQ-MEDL 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pch2NP_001287235.1 AAA 166..315 CDD:214640 48/157 (31%)
AAA 169..314 CDD:278434 46/147 (31%)
CG4701NP_609721.1 Parvo_NS1 47..>152 CDD:305166 22/80 (28%)
AAA 130..265 CDD:214640 47/152 (31%)
AAA 133..265 CDD:278434 47/149 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.