DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pch2 and vcp

DIOPT Version :9

Sequence 1:NP_001287235.1 Gene:pch2 / 41013 FlyBaseID:FBgn0051453 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_958889.1 Gene:vcp / 327197 ZFINID:ZDB-GENE-030131-5408 Length:806 Species:Danio rerio


Alignment Length:245 Identity:65/245 - (26%)
Similarity:108/245 - (44%) Gaps:46/245 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 LWENLIYETGLKEKLLKFALSALMFSEHRVDTNVIACNRLILLHGPPGTGKTSLCKALAQKLSIR 193
            |.|.:.|.....:|.|||.::.               ::.:|.:||||.|||.|.||:|.:    
Zfish   489 LQELVQYPVEHPDKFLKFGMTP---------------SKGVLFYGPPGCGKTLLAKAIANE---- 534

  Fly   194 TQGSYAYTHLVEINSHSLFSKWFSESGKLVAQLFNKIAELVSDPNNLVCVL-IDEVESLAYARSA 257
                 ...:.:.|....|.:.||.||...|.::|:|..:...      ||| .||::|:|.||..
Zfish   535 -----CQANFISIKGPELLTMWFGESEANVREIFDKARQAAP------CVLFFDELDSIAKARGG 588

  Fly   258 MSSNEPRDAMRVVNAVLTQLDSLKTCPNVLILATSNLAQSIDLAFV--DRADIRLFIGYPGISAI 320
            ...:....|.||:|.:||::|.:.:..||.|:..:|....||.|.:  .|.|..::|..|.    
Zfish   589 NVGDGGGAADRVINQILTEMDGMSSKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPD---- 649

  Fly   321 REIYKGMLAELMSAGVLQREVLESEDAEEGLLTQLAERSVGLSGRTLRKL 370
                     |.....:|:..:.:|..:::..|..||:.:.|.||..|.::
Zfish   650 ---------EKSRIAILKANLRKSPISKDVDLDFLAKMTNGFSGADLTEI 690

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pch2NP_001287235.1 AAA 166..315 CDD:214640 47/151 (31%)
AAA 169..314 CDD:278434 47/147 (32%)
vcpNP_958889.1 CDC48 25..764 CDD:273521 65/245 (27%)
CDC48_N 25..107 CDD:280513
CDC48_2 131..191 CDD:215011
AAA 241..370 CDD:278434
P-loop_NTPase 452..>534 CDD:304359 19/59 (32%)
AAA 514..647 CDD:278434 47/147 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 708..727
Vps4_C <718..760 CDD:286426
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 768..806
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.