DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pch2 and Nvl

DIOPT Version :9

Sequence 1:NP_001287235.1 Gene:pch2 / 41013 FlyBaseID:FBgn0051453 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001099450.1 Gene:Nvl / 289323 RGDID:1311270 Length:855 Species:Rattus norvegicus


Alignment Length:355 Identity:100/355 - (28%)
Similarity:147/355 - (41%) Gaps:86/355 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EVCLRGNDLRSNAIRNNVETALKAYFQT-ARK--LPRNVSFL-----------PDLTAEQTE--- 60
            ||||...|          |.:.:...|| .||  ||...:|.           .||.|...|   
  Rat   428 EVCLGIPD----------EASRERILQTLCRKLRLPETFNFSHLAHLTPGFVGADLMALCREAAV 482

  Fly    61 -HVHSVLLER--------DNGGVQPLKVAETKFRFHFYATRPEEGQ------LGLFS-----GEE 105
             .||.||:.|        :.||:.    ::.:......|..|.|.|      |||..     .||
  Rat   483 CAVHRVLMRRQEQQRTEPETGGLP----SDGEQGRSLGAEPPSETQDELQRLLGLLRDQDPISEE 543

  Fly   106 GSDGI-----DSIVAASHALLPAAQFVGL-------WENLIYETGLKEKLLKFALSALMFSEHRV 158
            ...|:     |.|||.|. :.|:|:..|.       |.::.....::|:|....|:.:...|...
  Rat   544 QMQGLCLELNDFIVALSE-VQPSAKREGFVTVPNVTWADVGALEDIREELTMAILAPVRNPEQFR 607

  Fly   159 DTNVIACNRLILLHGPPGTGKTSLCKALAQKLSIRTQGSYAYTHLVEINSHSLFSKWFSESGKLV 223
            ...::| ...:||.||||.|||.|.||:|.:..:         :.:.:....|.:.:..||.:.|
  Rat   608 ALGLVA-PAGVLLAGPPGCGKTLLAKAVANESGL---------NFISVKGPELLNMYVGESERAV 662

  Fly   224 AQLFNKIAELVSDPNNLVCVL-IDEVESLAYARSAMSSNEPRDAMRVVNAVLTQLDSLKTCPNVL 287
            .|:|.:.      .|:..||: .|||::|...|   |..|...::||||.:||::|.|:|...|.
  Rat   663 RQVFQRA------KNSAPCVIFFDEVDALCPRR---SDRETGASVRVVNQLLTEMDGLETRQQVF 718

  Fly   288 ILATSNLAQSIDLAFV--DRADIRLFIGYP 315
            |||.:|....||.|.:  .|.|..||:|.|
  Rat   719 ILAATNRPDIIDPAILRPGRLDKTLFVGLP 748

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pch2NP_001287235.1 AAA 166..315 CDD:214640 51/151 (34%)
AAA 169..314 CDD:278434 50/147 (34%)
NvlNP_001099450.1 Nucleolin_bd 2..71 CDD:406995
CDC48 <255..855 CDD:273521 100/355 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.